KEGG   Brevundimonas sp. LM2: BZG35_05475Help
Entry
BZG35_05475       CDS       T04750                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
brl  Brevundimonas sp. LM2
Pathway
brl00500  Starch and sucrose metabolism
brl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BZG35_05475
Enzymes [BR:brl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BZG35_05475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AQR61164
UniProt: A0A1S6ETA1
LinkDB All DBs
Position
complement(1093620..1095992)
Genome map
AA seq 790 aa AA seqDB search
MMGVALVPLAACASMSPTPDAAVRPMIEAVAPGAPGEKPTWSSAVKTGVGASYEAYVDGQ
YKDGGPTGEVSRVWFSIADGVLTETMYGLIHEAQIKTMRFAVMTETGLSVEGTDTTARTE
YLHTDAQGRPLSPAYRITTTDKQGRYEIEKRIYTDPNGQSLVVRTTVRALKGAVTPYLML
EPHMANTGIGDRGEATPGTLTAWEGDVALTLVPSAPFEAASVGFMGASDALTDLADGRLD
HAYAASGEATGNLMLTGALPVVEAGGALSRDFVIGFGPDASAAQARAAATSRDLDGALAR
FNGEGTAVGWQDWIGSLTELPRMAEQATDGGKLAYASALMLKVQEDRTHAGALIASLSNP
WGDTVDASTASTGYKAVWPRDFYQVAMALMALGDTQTPVAAFRYLPQVQVSDRTPGNTGA
TGWFLQKTHVDGQIEWVSVQLDQTAMPIMLGWKLWKAGQVSDAEMARMYAAMIKPAADFL
VDGGTIGLDWNDRTVTPPWSQQERWEEQEGHSPSTTAAVIAGLTVASEIALASGDAASAT
RYQAAADDYAAKVEARTFTTNGTLGDGNYFLRVSRNEDPNDRAPIGEANAQAALPEDRII
DGGFLELVRYGVRAADAKSITDTLAEYDDQTIEDHLRVRYDFGPEGDKTPGWRRYGNDGY
GENIETAGNYGDGGMTPGQRGRVWPFFTGERGTYELARLLQDGTPDPAALDRIRQTYVRG
MERFANDGLLLPEQVWDGVGAMPEDYGVGRGTDSATPLAWTHAEYLKLLRSIADRRVWDR
YAPVEDRYAR
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgatgggcgtcgccctggtccccctggccgcctgcgcctcgatgagccccacccccgac
gccgccgtccggccgatgatcgaagcggtcgctcccggtgccccgggcgaaaaaccgacc
tggtccagcgcggtcaagaccggcgtcggggcctcgtacgaggcctatgtcgacggccaa
tacaaggacggcggtccgaccggcgaggtttcgcgcgtctggttctcgatcgccgacggc
gtcctgaccgagaccatgtacggcctgatccacgaggcccagatcaagaccatgcgcttc
gccgtgatgaccgagaccggcctgtcggtcgagggcaccgacaccacggcgcggaccgaa
tatctgcacacggacgcccagggccggcccctgtcacccgcctatcgcatcaccaccacc
gacaaacagggccgctacgagatcgagaagcggatctacaccgatccgaacggccagagc
ctggtcgtgcgcaccaccgtccgcgcgctgaagggggcggtgacgccctatctgatgctg
gagccgcacatggccaataccggcatcggcgatcgcggcgaagcgacacccggcaccctc
accgcctgggagggcgacgtcgccctgaccctggtgcccagcgcgccgttcgaggccgcc
agcgtcggcttcatgggggcttccgacgccctgaccgacctggccgacggtcggctggac
cacgcctatgcggcctcgggcgaggccacgggtaacctcatgctgacgggggccctgccg
gtcgtcgaagcgggcggggccctgagccgcgacttcgtcatcggcttcgggcccgatgcc
tccgccgcccaggcgcgggcggccgcgacgtcgcgcgatctggacggcgctctggcccgt
ttcaacggcgaagggacggccgtcggctggcaggactggatcggttcgctgaccgaactg
ccgcgcatggccgaacaggccaccgacggcggcaagctggcctatgcctcggcactcatg
ctgaaggtgcaggaggaccggacgcatgccggggccctgatcgcctcgctgtccaacccc
tggggggacacggtcgacgcctcgaccgcctcgaccggctacaaggccgtctggccgcgc
gacttctatcaggtggccatggcgttgatggcgctgggcgacacccagacgcccgtcgcc
gccttccgctacctgccccaggtccaggtcagcgaccgcacgccgggcaataccggggcg
accggctggttcctgcagaagacccacgtcgacggccagatcgaatgggtctcggtccag
ctggaccagaccgccatgccgatcatgctgggctggaaactgtggaaggccggccaggtc
tccgacgccgagatggcgcgcatgtatgccgcgatgatcaagcccgccgccgacttcctg
gtcgacggcggcaccatcggcctggactggaacgaccgcacggtgacccctccctggtcg
cagcaggagcggtgggaggagcaggagggccactcgccttccaccaccgccgccgtcatc
gccggcctgaccgtcgcctccgagatcgccctcgcctctggcgacgccgcctccgccacc
cgctatcaggccgcggccgacgactatgcggccaaggtcgaggcccggaccttcaccacc
aacggcaccctgggcgacggcaactatttcctgcgcgtgtcgcgcaacgaggatcccaat
gaccgcgccccgatcggcgaggccaatgcccaggccgccctgcccgaggaccgcattatc
gacggcggcttcctggagctggtgcgctacggcgtccgcgccgccgacgccaagtcgatc
accgacaccctggccgaatacgatgaccagacgatcgaggatcacctgcgggtccgctac
gacttcggtcccgaaggcgacaagacccccggctggcggcggtacggcaacgacggctat
ggcgagaacatcgagaccgccggcaactatggcgacggcggcatgacgcccggccagcgc
ggccgggtctggcccttcttcaccggcgagcgcggcacctatgagctggcacgcctgctg
caggacggcacccccgatcccgccgccctcgaccggatccgccagacctatgtccggggc
atggagcggttcgccaacgacggcctgctgctgccggaacaggtctgggacggcgtgggg
gcaatgcccgaggactatggggtcgggcggggcaccgactcggccacacccctggcctgg
acccatgccgagtatctgaagctgctgcgttccatcgcggaccgccgggtgtgggaccgc
tacgccccggtcgaggaccgctacgcccgctag

DBGET integrated database retrieval system