KEGG   Brevundimonas sp. LM2: BZG35_08145Help
Entry
BZG35_08145       CDS       T04750                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
brl  Brevundimonas sp. LM2
Pathway
brl03030  DNA replication
brl03410  Base excision repair
brl03420  Nucleotide excision repair
brl03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:brl00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BZG35_08145
   03410 Base excision repair
    BZG35_08145
   03420 Nucleotide excision repair
    BZG35_08145
   03430 Mismatch repair
    BZG35_08145
Enzymes [BR:brl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BZG35_08145
    6.5.1.6  DNA ligase (ATP or NAD+)
     BZG35_08145
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     BZG35_08145
DNA replication proteins [BR:brl03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    BZG35_08145
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     BZG35_08145
DNA repair and recombination proteins [BR:brl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     BZG35_08145
   NER (nucleotide excision repair)
    Other NER factors
     BZG35_08145
   MMR (mismatch exicision repair)
    Other MMR factors
     BZG35_08145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N
Motif
Other DBs
NCBI-ProteinID: AQR61623
UniProt: A0A1S6EUD6
LinkDB All DBs
Position
1648499..1650190
Genome map
AA seq 563 aa AA seqDB search
MRAFAELLDRLSLTGSRNAKLVLLRDYLRATPDPDRGWALAALTGELSFNAAKPAMIRRA
VEARVDPVLFRWSYDYVGDLAETVALIWPADPDHRPNREPELGEIVDALMGAKRGEVQGL
LEGWLDALAPKGRWALLKLVTGALRVGLSARLAKTATAMVRPESISQPPDPEGDETVIGL
DPVDVSEIEEVWHGLEAPYGDLFAWLEGRAERPSPDAPGRFRPVMLAVAIDEAVDFAKLR
PADYAAEWKWDGIRVQAVREAGVTRLYSRTGDEISATFPDVMEALAFEGAIDGELLVWRD
GAVAPFGDLQQRLNRKAVDAKTMAAYPAAIVAYDALALDGEDLRGLPLRERRARLEAMVA
AHAGERLHLSPLVAYDSWEALGVLRADPPVGAAAEGLMLKRWDSVYVAGRPKGPWFKWKR
DPHSIDCVLMYAQRGHGKRSSFYSDFTFGVWTADGALTPVGKAYFGFTDEELKQLDKFVR
DHTIDRFGPVRSVKAGRDFGLVLEIAFEGLNRSPRHKSGVAMRFPRIGRIRWDKPAREAA
TIAEVMDLLDAIEGGGGRIGKSG
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcctttgccgaactgctggatcgcctgtcgctgacgggctcgaggaatgccaag
ctggtgcttctgcgcgactatctgcgcgccacgcccgacccggaccgcggttgggccctg
gcggccctgacgggcgagctcagcttcaatgcggccaagccggccatgatccgccgcgcg
gtcgaggcgcgggtcgatccggtgctgttccgctggtcgtacgactatgtcggcgatctg
gccgagacggtcgccctgatctggccggcggaccccgaccatcgccccaaccgcgagccg
gagctgggggagatcgtcgacgccttgatgggcgccaaacgcggggaggttcagggtctg
ctcgaaggctggctggacgccctggcgccaaaaggccggtgggccctgttgaagctggtg
accggggcgctgcgcgtcggcctgtcggcccggctggcgaagacggcgacggccatggtg
cgccctgagtccatatcgcagccgcccgatccggagggggacgagactgtgatcgggctg
gacccggtggacgtgtccgagatcgaggaggtctggcacgggctggaagccccctatggg
gatctgttcgcctggctggaagggcgggccgaacggcccagccccgacgcccccggccgt
ttccggcccgtcatgctggccgtcgccatcgatgaagcggtggacttcgcaaagctgagg
ccggccgactatgccgccgaatggaaatgggacggcatccgggtccaggcggtccgcgag
gcgggagtgacacgcctgtattcccgcacgggtgacgaaatctcggccacctttcccgac
gtgatggaggccctggcgttcgagggggcgatcgatggcgaactgctggtctggcgcgac
ggcgcggtggccccgttcggcgatctgcagcagcggctgaaccgcaaggccgtcgacgcc
aagaccatggccgcctatccggccgccatcgtggcctatgacgccctggcgctggacggc
gaggacctgcgcggtctgccgctgcgcgaacggcgcgcgcggcttgaggccatggtggcg
gcccatgcgggcgagcggctgcatctgtcgccgctggtcgcctacgacagctgggaggcc
ctgggcgtgctgcgcgccgaccctccggttggcgcggcggccgaagggctgatgttgaag
cgctgggacagcgtctatgtcgccggccgccccaaggggccctggttcaagtggaaacgc
gatccgcattccatcgactgcgtgctgatgtacgcccagcgcggccatgggaaacgctcc
agcttctattccgacttcaccttcggcgtctggaccgcggacggcgcgctgacgccggtc
ggcaaggcctatttcggcttcaccgatgaggagttgaaacagctcgacaagttcgtgcgc
gaccacaccatcgaccggttcggtcctgtgcgctcggtcaaggccgggcgggatttcggt
ctggtgctggagatcgccttcgaaggcctgaaccggtcgccccggcacaagtccggcgtg
gccatgcgcttcccccgcatcggccgcatccgctgggacaagcccgcgcgcgaggcggcg
accatcgccgaggtcatggacctgctcgacgccatcgaaggcggcggcggtcggatcggc
aagagcggctag

DBGET integrated database retrieval system