KEGG   Brevundimonas sp. LM2: BZG35_11245Help
Entry
BZG35_11245       CDS       T04750                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
brl  Brevundimonas sp. LM2
Pathway
brl00061  Fatty acid biosynthesis
brl00780  Biotin metabolism
brl01100  Metabolic pathways
brl01212  Fatty acid metabolism
Module
brl_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:brl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BZG35_11245
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BZG35_11245
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:brl01004]
    BZG35_11245
Enzymes [BR:brl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BZG35_11245
Lipid biosynthesis proteins [BR:brl01004]
 Fatty acid synthase
  Component type
   BZG35_11245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT 4HBT_2 MaoC_dehydratas AfsA PS-DH
Motif
Other DBs
NCBI-ProteinID: AQR62155
UniProt: A0A1S6EVN5
LinkDB All DBs
Position
complement(2260774..2261256)
Genome map
AA seq 160 aa AA seqDB search
MTDPTTTTDDIRIDYAEVMRRLPHRYPFLLVDKAEAFVPATSIVGIKNVSHNEPFFQGHF
PIDPVMPGVLIVEAMAQTGALLMSKTLDVAVADKVIMFMSIDGVRFRKPARPGDQLRMEV
KVTRARGDAYKFRGETFIDGKLAAEAEFMAMVVKVDQPAT
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacccgacgacgacgactgacgacatccgcatcgactatgctgaggtgatgcgg
cgcctgccgcaccgctaccccttccttctggtcgataaggccgaggccttcgtgcccgcc
acctcgatcgtcggcatcaagaacgtcagccacaacgagcccttcttccagggccatttc
ccgatcgacccggtcatgccgggcgtcctgatcgtcgaggccatggcccagaccggggcg
ttgctgatgtccaagaccctggacgtcgccgtggccgacaaggtcatcatgttcatgtcg
atcgatggcgtccggttccgcaagcccgcccggccgggcgatcagctgcgcatggaggtc
aaggtcacccgcgcgcgcggcgacgcctacaaattccggggcgagaccttcatcgacggc
aagctggccgccgaggccgagttcatggccatggtggtcaaggtcgaccagcccgcgaca
tga

DBGET integrated database retrieval system