KEGG   Brevundimonas sp. LM2: BZG35_13910Help
Entry
BZG35_13910       CDS       T04750                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
brl  Brevundimonas sp. LM2
Pathway
brl00030  Pentose phosphate pathway
brl01100  Metabolic pathways
brl01110  Biosynthesis of secondary metabolites
brl01120  Microbial metabolism in diverse environments
brl01130  Biosynthesis of antibiotics
brl01200  Carbon metabolism
brl01230  Biosynthesis of amino acids
Module
brl_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
brl_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:brl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BZG35_13910
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    BZG35_13910
Enzymes [BR:brl01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     BZG35_13910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C TPP_enzyme_C DXP_synthase_N E1_dh
Motif
Other DBs
NCBI-ProteinID: AQR62618
UniProt: A0A1S6EX47
LinkDB All DBs
Position
2790237..2792231
Genome map
AA seq 664 aa AA seqDB search
MADAKIASNKATVKQMADAIRVLAMDGVEKANSGHPGMPMGMADVATVLFSKFLKFDASR
PDWADRDRFILSAGHGSMLIYALLHLTGYKAASTEELSNFRQWGSKTAGHPEFGHMPGVE
TTTGPLGQGLANSVGFAMAERHLAAKYGDDLVDHRTWVIAGDGCLMEGVSQEAIALAGRY
RLNKLTVLWDDNAITIDGAVSLSDATDQKARFKAAGWAVKAIDGHDVKAIKSALQWATRQ
DRPTLIACKTKIGRGAATLEGSHKTHGAALGAAEIAATRLGLAWDHEPFVIPEPIEKAWR
KVGKRGGKDRKAWEDRLASSPQALEFTRSMSGDLPERAFDALNAGIAQLLVDQPAQATRQ
ASGAALETLFAAVPEMIGGSADLTGSNNTFVKGTPIFDAPTYEGRYVNYGIREFGMAAAM
SGMALHGGVIPYGGTFMVFSDYSRPAIRMAALMGIRVIHVLTHDSIGLGEDGPTHQPVEH
LAALRAIPNLLVFRPADTVEAFECWQLALQHKGTPSALCLSRQKTAAVRLTAADENLSGR
GAYELKAASGEARVTLFATGTEVPIALKAAATLEAEGTPTRVVSAPCFELFEQQDAAYQA
SVIGRGTVRVAVEAAIQQGWERFIGEDGAFVGMTGFGASAPADVLYREFGITADAVVAAA
KARL
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
gtggccgacgccaagatcgcctccaacaaggccaccgtgaaacagatggcggacgccatc
cgcgttctggccatggacggggtggaaaaggccaacagcggccaccccggcatgccgatg
ggcatggccgacgtggccacggtgctgttctcgaagtttctgaagttcgacgccagccgc
cccgactgggccgaccgcgaccgcttcatcctgtcggcgggccacggctcgatgctgatc
tacgccctgttgcacctgaccggctacaaggccgccagcaccgaggagctgtcgaacttc
cgtcagtggggttccaagaccgccggccaccccgagttcgggcacatgcccggcgtcgag
accacgaccggcccgctgggccagggcctggccaactccgtcgggttcgccatggccgag
cgccatctggcggcgaaatacggcgacgacctggtcgaccaccgcacctgggtcatcgcc
ggcgacggctgcctgatggagggggtctcgcaggaggccatcgccctggccggccgttac
aggctgaacaagctgaccgtcctgtgggacgacaacgccatcaccatcgacggcgcggta
tccctgtccgacgccaccgaccagaaggctcgcttcaaggccgccggctgggccgtcaag
gcgatcgacggtcacgacgtcaaggccatcaagtccgccctgcaatgggcgaccagacag
gacaggcccaccctcatcgcctgcaagaccaagatcggtcgcggcgcggccaccctggag
ggcagccacaagacccacggcgcggccctgggggcggccgagatcgccgccacccgcctg
ggcctggcctgggatcacgaacccttcgtcatccccgagccgatcgaaaaggcctggcgc
aaggtcggcaagcgcggcggcaaggaccgcaaggcctgggaagaccgcctcgcatcctcg
ccccaggcgctggagttcacccgctccatgtccggcgacctgccggaacgcgccttcgac
gccctgaacgccggcatcgcccagctgctggtcgaccagccggcccaggccacccgccag
gcctccggcgccgcgctggagactctgttcgccgccgtgcccgagatgatcggcggctcg
gccgacctgaccggctccaacaacaccttcgtcaagggcacgccgatcttcgacgccccg
acctatgagggtcgctacgtcaactacggcatccgcgagttcggcatggcggcggccatg
agcggcatggccctgcacggcggggtcatcccctacggcggcaccttcatggtgttctcg
gactacagccgcccggccatccgcatggcggccctgatgggcatccgcgtcatccacgtc
ctgacccacgactccatcggcctgggcgaggacggcccgacccaccagccggtcgagcat
ctggccgccctgcgcgccatccccaacctgctggtcttccgccccgccgacacggtcgag
gccttcgaatgctggcagctggccttgcagcacaagggcaccccgtcggccctgtgcctg
tcgcgccagaagaccgccgccgtccgcctgaccgccgcggacgagaacctgtcgggtcgc
ggggcctatgagctgaaagccgcctcgggcgaggcccgggtcaccctgttcgccaccggc
accgaggtcccgatcgccctgaaggccgccgcgaccctggaggccgaaggcaccccgacc
cgcgtcgtctcggccccctgtttcgaactgttcgaacagcaggacgccgcctaccaggcc
tcggtcatcggccggggcacggtgcgggtggcggtcgaggccgccatccagcagggctgg
gagcggttcatcggcgaggatggagccttcgtcggcatgaccggcttcggcgcctcggcc
cccgccgacgtcctgtaccgcgagttcggcatcaccgccgacgccgtggtggcggcggct
aaggcccggctttga

DBGET integrated database retrieval system