Brevundimonas sp. LM2: BZG35_17195 Help Entry BZG35_17195       CDS       T04750                                  Name (GenBank) hypothetical protein   KO K03111   single-strand DNA-binding protein Organism brl  Brevundimonas sp. LM2 Pathway brl03030   DNA replication brl03430   Mismatch repair brl03440   Homologous recombination Brite KEGG Orthology (KO) [BR:brl00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     BZG35_17195    03430 Mismatch repair     BZG35_17195    03440 Homologous recombination     BZG35_17195  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:brl03032]     BZG35_17195    03400 DNA repair and recombination proteins [BR:brl03400]     BZG35_17195    03029 Mitochondrial biogenesis [BR:brl03029]     BZG35_17195 DNA replication proteins [BR:brl03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BZG35_17195 DNA repair and recombination proteins [BR:brl03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      BZG35_17195   TLS (translesion DNA synthesis) factors    Other SOS response factors     BZG35_17195 Mitochondrial biogenesis [BR:brl03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA replication factors    Other Mitochondrial DNA replication factors     BZG35_17195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB Motif Other DBs NCBI-ProteinID:  AQR63189 UniProt:  A0A1S6EYM3 LinkDB All DBs Position 3503391..3503762 Genome browser AA seq 123 aa AA seqDB search MQSMMFTGRLAADPQISPDFGKAVFRLLEKRGVDSAGKDRLVGVNCVSWSKGLNEKVIAR GLAQGCEAVVIGAFIDTAYAAKGGAERTAKELVINRLTVLDWAEDRGAARADADADADAR VGA NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgcaatccatgatgttcaccggccggctggcggccgacccccagatcagcccggacttc ggcaaggcggtgttccggcttctcgaaaagcgcggcgtcgacagcgccggaaaggaccgg ctcgtcggagtcaactgcgtcagctggtcgaaaggcctcaacgaaaaagtcatcgcgcgc ggcctggcccagggctgcgaagcggtcgtcatcggggccttcatcgacacggcctatgcg gccaagggcggtgcggagcggacggccaaggagctggtgatcaaccggctgaccgttctc gattgggccgaggaccgaggcgcggctcgcgccgacgccgacgccgacgccgacgcccgc gtcggcgcctga

DBGET integrated database retrieval system