KEGG   Brachyspira murdochii: Bmur_0946Help
Entry
Bmur_0946         CDS       T01229                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
brm  Brachyspira murdochii
Pathway
brm00500  Starch and sucrose metabolism
brm01100  Metabolic pathways
brm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bmur_0946
Enzymes [BR:brm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Bmur_0946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Capsule_synth
Motif
Other DBs
NCBI-ProteinID: ADG71042
UniProt: D5U8L9
LinkDB All DBs
Position
1115180..1117741
Genome map
AA seq 853 aa AA seqDB search
MKLNKYMVSPSVPKELEPLIEITKNFWWCWNQKAVTLLRTIDIDNWDKRDHNPIRVLGES
LQERFDAMLQDDAAMMSLAEVYDEFKTYMKQETWYDSLSEDKKAPNEKIAYFSFEYGLHE
SLPNYSGGLGILSGDHLKSASDLGLPLVAMGLLYRKGYFRQYLNADGWQQEYDIENDFFN
LALEKVLDKNGETMKVDVDLPGRKVYAQIWKANVGRIELYYLDANIEENSVEDRDITAQL
YGGNLETRIQQEILLGIGGVKALEKLGIKPTIYHMNEGHSAFLSLERIRQLMENNHLDKN
TAREVVYSSNIFTTHTPVPAGNDIFPIDMVQKYFYEYVKHIDMSMDEFIRLGRINPDDQK
ESFCMTVLALNLSAENNGVSELHGHVSRAMWKDIWKGVPVNELPIDSITNGIHTLSWISF
DMQNLLDRYLGPRWRTKPLEYEIWERVQKIPDAELWRTHERRKERLIDFCRERLKAQITN
RGFTKKEIEHAEQILSPEALTIGFARRFATYKRGTLLFKDLERLKKIINNSERPVQIIFA
GKAHPHDNGGKELIRNIAEICRREDFRDHIVFLEDYDINVARYMVQGVDVWLNNPRRPLE
ASGTSGMKVPPNGGLNFSVLDGWWDEAYDGQNGWAIGNREEYTDLEYQDEVESKALYNVL
ENEIIPLFYERGRDDIPRQWVAAMKWSMQTVCPVFSTNRMVADYFHKFYNNASKRYLNMT
ENEFAKAKDLKTWKQDIFSKWSKVSFENTISEMPSRNLKVGSKFEVKTIVNLGDIAPDSV
RVELYYGKLSMKEDILDPVTVEMKHSADLGNGRHSFSGTLECINSGQSGYAIRMYPYHKD
LSYKFDMKLIIWG
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaataaatatatggtttcgccatctgtaccaaaagaattggagccacttata
gaaattactaaaaacttttggtggtgctggaatcagaaagcagtaactttattaagaaca
atagatattgataactgggataaaagagatcataatccaataagagtacttggagaatct
ttacaggaacgttttgatgctatgcttcaggacgatgctgctatgatgagtttagcagaa
gtttatgatgagttcaaaacttacatgaaacaggaaacttggtatgatagtttaagcgaa
gataaaaaagctcctaatgaaaaaatagcttatttttcttttgaatatggtttgcatgaa
tctttacctaattattccggcggtcttggtatattatccggtgatcacttaaaatctgct
agtgatttgggacttcctttggtagctatgggactattatatagaaaaggttatttcaga
caatatttaaatgctgacggctggcagcaggaatatgatatagaaaatgatttctttaac
ttagctttagaaaaagttttagataaaaacggcgaaactatgaaggtagatgttgattta
cccggcagaaaagtttatgctcaaatatggaaagcaaatgtaggaagaatagaactttac
tatttagatgccaacatagaagaaaacagcgttgaagacagagatattacagctcagctt
tacggcggtaatttggaaactagaatacagcaggaaatacttttaggtataggcggagta
aaagcattagaaaaattgggtattaaacctacaatttatcatatgaatgaaggacacagt
gcttttctttctttagagagaataagacagttaatggaaaataatcatttagataaaaat
acagcaagagaagttgtatatagttcaaatatatttacaactcatactcctgtgcctgct
ggtaatgatatattccctatagatatggttcagaaatatttttatgaatatgttaagcat
atagatatgagtatggacgagtttataagactaggaagaattaatccagatgatcaaaaa
gaaagtttctgtatgactgttcttgctcttaatttgtcagctgaaaataacggagtaagc
gagcttcatggacatgtatccagagctatgtggaaagatatatggaaaggtgttcctgtt
aatgaacttcctatagattctattactaacggaattcacactttaagctggatatctttt
gatatgcagaacttacttgacagatatttaggtcctcgttggagaactaaacctttagaa
tatgaaatttgggagagagttcaaaaaatacctgatgcagaactctggagaactcatgaa
agaagaaaagaaagacttattgatttctgccgtgaaagattaaaggctcaaattacaaac
agaggatttacaaaaaaagaaatagaacatgctgaacagatactttctcctgaagcctta
acaataggctttgcaagaagatttgctacatataaaagaggtactttgcttttcaaagat
ttggaaagattaaaaaagataattaataattctgaaagaccagtacaaataatatttgca
ggtaaagctcacccgcatgataatggcggtaaagaattgataagaaatattgccgagatt
tgcagaagagaagatttcagagatcatatagtatttttagaagactatgatataaatgta
gccagatatatggttcagggtgtagatgtatggcttaacaaccctagaagacctttagaa
gcaagcggtacaagcggcatgaaagttccgccaaacggaggattaaacttcagtgtatta
gacggctggtgggacgaggcttatgacggacaaaacggatgggctattggcaacagagaa
gagtatactgacttggaatatcaagatgaggttgaaagtaaagctctctataatgtatta
gaaaatgaaattatacctctattctatgaaagaggaagagatgatatacctagacaatgg
gttgctgctatgaaatggagtatgcagactgtttgtccggtattttctactaatagaatg
gttgccgattacttccataagttctacaacaatgcaagcaaaagatatcttaatatgact
gaaaatgaatttgctaaagctaaagatttgaaaacttggaagcaggatatattctctaaa
tggtctaaagtatcatttgaaaatactatatctgaaatgccttcaagaaacttaaaagta
ggaagcaaatttgaagtaaaaactatagttaatttgggcgatatagctccggattctgta
agagtagaactttactatggtaaattaagcatgaaagaagatatattagatccagttaca
gttgagatgaagcattctgctgatttaggaaacggaagacattcattctctggaactttg
gaatgcataaacagcggtcaaagcggttatgctataagaatgtatccatatcataaagat
ttgagctacaaatttgatatgaagctaattatatggggttaa

DBGET integrated database retrieval system