KEGG   Breoghania sp. L-A4: D1F64_09760Help
Entry
D1F64_09760       CDS       T05594                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
brn  Breoghania sp. L-A4
Pathway
brn00970  Aminoacyl-tRNA biosynthesis
brn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    D1F64_09760
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:brn03029]
    D1F64_09760
Enzymes [BR:brn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     D1F64_09760
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     D1F64_09760
Mitochondrial biogenesis [BR:brn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    D1F64_09760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AXS40291
UniProt: A0A346R1D2
LinkDB All DBs
Position
2103499..2104980
Genome map
AA seq 493 aa AA seqDB search
MSLVDTRTPDPKKFIKGAMGDWEMVIGLEVHAQVTSNSKLFSGASTEFGNAPNDNVSLVD
AAMPGMLPVINEECVRQAVRTGLGLKAEINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG
EGIVYLDMPDERVEVGVERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVSKPDIRS
SDEAKAYLTKLRTILRYLGTCDGNMEQGSMRADINVSVRKPGGDFGTRCEIKNVNSIRFA
GQAIEYEARRQIGILEDGGSIDQETRLFDPGRGETRSMRSKEEAHDYRYFPDPDLLPLVF
DQAFVDDLASHLPELPDDKKARFVADFGLSAYDADILVAEKISADFFEAVAKGRDAKLSA
NWVINELFGRLNKEGHDVTTSPVSADQLGGIIDLIVAGEISGKIAKDLFEIVWSEGGDPA
AIVETRGMKQVTDLGAIEAIVNEIVEANPEKAEQAREKPGLLGWFVGQVMKASQGKANPK
AVNDLLRKKIGID
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcgttgacacccgtacccccgatccgaagaaattcatcaagggcgccatgggc
gactgggagatggtcatcggtctcgaggtgcatgcgcaggtgacctccaactcgaagctg
ttctccggcgcctcgaccgaattcggcaacgcgccgaacgacaacgtgtcgctggtcgac
gctgccatgccgggcatgctgccggtgatcaacgaggaatgcgtccgtcaggccgtgcgc
accggtctggggctgaaggccgagatcaacctcaagagcgtcttcgaccgcaagaactac
ttctatcccgatctgccgcagggctaccagatctcgcagttcaagcagccgatcgtcggc
gagggcatcgtctatctcgacatgccggacgagcgcgtcgaggtcggcgtcgaacggctg
catctggagcaggacgccggcaagtcgatgcacgaccagcatcccaccatgtcgttcgtc
gatctgaaccgctcgggcgtcgcgctgatggagatcgtctccaagccggacatccgctcg
tccgacgaggccaaggcctatctcaccaagctgcgcaccatcctgcgctacctcggcacc
tgcgacggcaacatggagcagggctccatgcgcgccgacatcaacgtttccgtgcgcaag
cccggcggtgacttcggcacccgctgcgagatcaagaacgtcaactcgatccgcttcgcc
ggccaggcgatcgaatacgaggcgcgccgccagatcggcattctcgaggatggcggctcc
atcgaccaggaaacccgcctgttcgatccgggccgtggcgagacgcgctccatgcgctcc
aaggaagaggcgcacgactaccgctacttccccgatcccgacctgctgccgctggtcttc
gaccaggccttcgtcgacgatctcgcgtcccatctgccggaactgccggacgacaagaag
gcgcggtttgtcgccgacttcggcctgtcggcctatgacgcggacattctggtggcggaa
aagatctcggccgacttcttcgaggccgtggccaagggccgcgacgcgaaactgtccgcc
aactgggtgatcaacgagctcttcggacggctgaacaaggaaggccacgacgtcaccacc
tcgccggtttccgccgaccagctcggcggcatcatcgatctgatcgttgcgggcgagatt
tcgggcaagatcgccaaggatttgttcgagattgtctggtccgagggcggcgatccggcc
gcaatcgtcgagacgcgcggcatgaagcaggtcaccgatctcggcgccatcgaggcgatc
gtcaacgagatcgtcgaggccaatcccgagaaggccgaacaggcgcgcgagaagccgggc
cttctgggctggttcgtcggtcaggtgatgaaggccagccagggcaaggccaaccccaag
gccgtcaacgatcttctgcgcaagaagatcggcatcgattag

DBGET integrated database retrieval system