Breoghania sp. L-A4: D1F64_13385 Help Entry D1F64_13385       CDS       T05594                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism brn  Breoghania sp. L-A4 Pathway brn00790   Folate biosynthesis brn01100   Metabolic pathways brn01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:brn00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     D1F64_13385 (folB) Enzymes [BR:brn01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      D1F64_13385 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      D1F64_13385 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      D1F64_13385 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB GPW_gp25 Motif Other DBs NCBI-ProteinID:  AXS40853 UniProt:  A0A346R2Z4 LinkDB All DBs Position 2949075..2949437 Genome browser AA seq 120 aa AA seqDB search MERIILEDLAFYAFHGVHDEEARLGQRFHVDMTVHADLSKAVASDHYADTICYASLVKTI EEVVTGGRFNLIERLAGAIADAVLAVDPRIDTVDIRVHKPGAPLPLSTGHVSIALTKSRG NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggaacgtataatccttgaagatctggccttttacgcctttcacggcgtgcacgacgaa gaggcgcgcctcggccagcgcttccatgtcgacatgacggtccacgccgatctctcgaag gcggtggcgagcgaccactatgccgacacgatctgctacgcctccctggtcaagacgatc gaggaggttgtcaccggcggccgcttcaatctgatcgaacggctggcgggcgccatcgcc gatgcggtgctggcggtcgatccccgtatcgacaccgtggacatccgggtgcacaaaccc ggcgcgcccttgccgctgagcaccggtcacgtctcgatcgctctgacgaagtcccgcggc tag

DBGET integrated database retrieval system