KEGG   Breoghania sp. L-A4: D1F64_14550Help
Entry
D1F64_14550       CDS       T05594                                 

Definition
(GenBank) sulfite exporter TauE/SafE family protein
  KO
K07090  uncharacterized protein
Organism
brn  Breoghania sp. L-A4
Brite
KEGG Orthology (KO) [BR:brn00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    D1F64_14550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AXS41021
UniProt: A0A346R3G2
LinkDB All DBs
Position
complement(3204504..3205241)
Genome map
AA seq 245 aa AA seqDB search
MDTLIFLAAAVFVLAGTIKGTVGIGLPTAAVGILAQFIDPHLALALVVFPIMTGNAWQAY
RAGGMLATLKRYWIFALVSMVALWLSTFVTAAISTDTLITVLGGVIVIFAVTSLAFTPPV
IPDRFDRLAQIIAGVLAGIMGGFTAIWAPPMVIYFIARRVDKDEFVRASGLLIFLGSLPL
CLGFWQSGLLTGPNALISLMMIVPTLLGFTFGEILRRRLNDNRFRTAVLLIFLAMGLNLI
RKALF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atcgacactctcatttttctggctgcggcggtgttcgtcctcgcggggacgatcaagggc
accgtcggcatagggttgcccacggccgcggtcggtattctggcgcagttcatcgatccg
catctggcgctcgcgctggtggtgttcccgatcatgaccggcaacgcctggcaggcgtat
cgcgcgggcggcatgctcgccacgctcaagcgctactggatttttgccctcgtctcgatg
gtcgcgctgtggctgagcacgtttgtcaccgccgccatcagcaccgacacgctgatcacg
gtgctgggcggagtgatcgtgatcttcgcggtcaccagcctggcgttcacgccgccggtc
attccggatcgcttcgaccggctggcgcagatcattgcgggcgtgctggcgggcatcatg
ggcgggttcacggcgatctgggcgccgccgatggtgatctatttcatcgcccgtcgcgtg
gacaaggacgagttcgtgcgcgcctcaggcctgctgattttcctcggcagcctgccgctg
tgtctcgggttctggcaatccggcctgctgaccggccccaatgcgctgatctcgctgatg
atgatcgtgccgacgctgctcgggttcacgttcggcgagatcctgcggcggcgtctcaac
gacaaccgcttccgcaccgccgtgctgctgattttcctggcgatggggctcaatctgatt
cgcaaggcgctgttctga

DBGET integrated database retrieval system