KEGG   Breoghania sp. L-A4: D1F64_16815Help
Entry
D1F64_16815       CDS       T05594                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
brn  Breoghania sp. L-A4
Pathway
brn00010  Glycolysis / Gluconeogenesis
brn00620  Pyruvate metabolism
brn01100  Metabolic pathways
brn01110  Biosynthesis of secondary metabolites
brn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:brn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D1F64_16815
   00620 Pyruvate metabolism
    D1F64_16815
Enzymes [BR:brn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     D1F64_16815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AXS41371
UniProt: A0A346R4G2
LinkDB All DBs
Position
complement(3684304..3685821)
Genome map
AA seq 505 aa AA seqDB search
MNKMDVTRSVKSPFATRYDNFIGGQWVEPATGAYFETTSPVNGQVLCQIARSNAEDVECA
LDAAHAAKDGWAATSVADRALVLNRIADCMEDNLDLLALAETWDNGKPIRETTIADLPLA
IDHFRYFAGVLRAQEGGISEIDKDTVAYHFHEPLGVVGQIIPWNFPLLMACWKLAPAIAA
GNCVVLKPAEQTPASIMLLMDLIGDLLPPGVLNVVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFEDVLAADDDFFDKAIEGFVMFALNQGEVC
TCPSRALIQESIYERFMERALKRVEAVIQGDPLDPATMIGAQASSEQLEKILSYIDIGKQ
EGAECLIGGERNQLPGDLAGGYYVKPTVFKGHNKMRIFQEEIFGPVVAVTTFRDDAEALE
IANDTLYGLGAGVWTRDGNRAYRFGRAIHAGRVWTNCYHAYPAHAAFGGYKQSGIGRETH
KMMLDHYQQTKNMLVSYAPQKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatggacgtgacccgttcggtcaagtcgccgtttgcgacgcgatacgacaat
ttcatcggcggtcagtgggtcgagccggccacgggcgcctatttcgagaccacttcgccg
gtcaacggccaggtgctgtgccagattgcccgctccaacgccgaagacgtcgaatgcgcc
cttgatgcggcccacgcggccaaggatggctgggcggccaccagcgttgcggatcgcgcg
ctggttctgaaccgcatcgccgattgcatggaggacaatctcgatctgctggcgctggcc
gagacctgggacaacggcaagccgatccgtgagacgacgatcgccgatctgccgctcgcc
atcgaccatttccgctatttcgccggtgtcctgcgcgcccaggaaggcgggatctcggag
atcgacaaggacacggtcgcctaccattttcacgaaccgctcggcgtcgtcggtcagatc
atcccgtggaacttcccgctgctgatggcctgctggaagctggcgccggcgattgccgcg
ggcaattgcgtcgtgctgaagccggccgaacagaccccggcctcgatcatgctgcttatg
gacctgatcggcgatctgctgccgcctggcgtgctcaacgtcgtcaacggcttcggcctg
gaggccggcaagcctctggcgtcaagcccgcgtatcgccaagatcgccttcaccggcgag
accacgaccggccggctgatcatgcagtatgccagccagaacctcatccccgtcacgctg
gagctcggcggcaagtcgccgaacatcttcttcgaggacgttctggcggccgatgacgac
ttcttcgacaaggcgatcgaggggtttgtcatgttcgcgctcaatcagggcgaggtgtgc
acctgcccgagccgcgcgctgattcaggaatcgatctacgagcgcttcatggaacgggcg
ttgaaacgggtggaggccgtcatccagggcgatccgctcgatcccgcgacgatgatcggc
gctcaggcatccagcgaacagctcgagaagattttgagctacatcgacattggcaagcag
gaaggggccgagtgtctgatcggcggggaacgcaatcaactgccgggcgatctcgccggc
ggctactacgtcaagccgacggtgttcaagggtcacaacaagatgcggatcttccaggag
gagatcttcggtcccgtggtcgcggttacgactttcagggatgacgccgaggcgctcgaa
atcgccaatgacacgctctatggcctcggcgccggcgtgtggacccgcgacggcaaccgc
gcctaccgcttcggccgggcgatccacgccggtcgcgtgtggaccaactgctatcacgcc
tatccggcacacgccgcattcggcggctacaagcagtcgggaattggccgcgagacccac
aagatgatgctcgaccactaccagcagaccaagaacatgctggtcagctacgctccgcag
aagctcggcttcttctga

DBGET integrated database retrieval system