KEGG   Breoghania sp. L-A4: D1F64_20705Help
Entry
D1F64_20705       CDS       T05594                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
brn  Breoghania sp. L-A4
Pathway
brn00564  Glycerophospholipid metabolism
brn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    D1F64_20705
Enzymes [BR:brn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     D1F64_20705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox Pyr_redox_2 NAD_binding_8 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AXS41984
UniProt: A0A346R675
LinkDB All DBs
Position
complement(4524796..4526397)
Genome map
AA seq 533 aa AA seqDB search
MKRHGATSSGQRGGSRVASTYDIFVVGGGVNGCGIARDAAGRGYSVFLAEMNDLASGTSS
WSTKLVHGGLRYLEHYEFRLVREALMEREVLWANAPHIIRPLRFLLPHHKGLRPAWLLRL
GLFLYDHLGGRKLLPATRTVDLKTDPAGAPLIDAFSTAFEYSDCFVDDARLVVLNARDAA
DRGAVIHTRTKCIAATRVGDLWHVTIEDGLSGERETVLARSLVNASGPWVDQVLRAPLGE
VEAHNVRLVQGSHIVVPKLFDHDRCYIFQNADGRIIFAIPYEGDFTLIGTTDREYEGDPA
DAAIAHDEIAYLCTAASEYFKAPVRESDVVWRFSGVRPLYDDGASKAQEATRDYVLKLER
GDGAPLINIFGGKITTYRRLAEAVVGKLASVIGARKQAWTRTAPLPGGDFPTLGFDDLCT
ELRARWPFLGVQTAERLARLYGTRVSIMLNDVPDAAGLGEIFGGDLSACEVAYLMDHEWA
RTAEDVLWRRTKLGLRLSESEAAALETWMAARNASGATGARGDDGDIKTANAV
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacacggggccacgagctccgggcaacgcggggggagccgggtggcgagcacc
tacgacattttcgtcgtcggaggcggggtgaacggttgcggcatcgcccgcgatgcggcc
gggcgcggctattcggtgtttctcgcggaaatgaacgatctcgcctcgggcacctcgtcg
tggtcgacgaagctcgtgcacggcggcctgcgctatctggagcactatgagttccggctg
gtgcgcgaggcgctgatggagcgcgaggtgctctgggccaacgcgccgcatatcatccgc
ccgctgcgcttcctgctgccgcatcacaagggcctgcgtccggcgtggctgctgcgtctg
gggctgtttctctacgatcacctgggcggccgcaagctgctgcccgcgacgcgcaccgtg
gatctgaagaccgaccccgcgggcgcgccgttgatcgatgcgttctccacggcgttcgaa
tattccgactgtttcgtcgacgacgcccggctggtggtgctcaacgcccgcgatgcggcg
gaccgcggcgcggtcatccacacccgcaccaaatgcatcgccgccacccgcgtcggcgat
ctgtggcatgtcaccatcgaggacgggttgagcggtgagcgtgagactgtgctggcgcgc
agcctggtcaacgccagcgggccatgggtcgatcaggttctgcgcgcgccgctcggcgag
gttgaggcgcacaacgtgcggctggtgcagggcagccacatcgtggtgccgaaactcttc
gatcacgaccgctgctacatcttccagaacgcggacgggcgcatcatcttcgccattccc
tatgagggcgacttcacgctcatcggcaccacggaccgcgagtacgagggagatcccgcc
gatgcggcgatcgcgcacgacgagatcgcctatctgtgcaccgcggcgagcgagtatttc
aaggcgccggtgcgcgagagcgatgtggtgtggcggttctcgggcgtgcgtccgctttac
gacgatggcgcgtccaaggcccaggaagccacccgcgactatgtgctcaagcttgagcgc
ggggacggggctccgctgatcaatattttcggcggcaagatcaccacctaccggcgcctc
gcggaggccgtcgtcggcaagcttgcatcggtgatcggcgcgcgcaagcaggcctggacg
cgcactgcgccgctgcccggaggggatttcccgacgctcgggtttgacgatctgtgcacc
gagcttcgcgcgcgctggccctttctcggcgtgcagacggccgagcggctggcgcggctc
tatggcacgcgggtttccatcatgctcaacgatgtgcccgacgcggcggggcttggagag
attttcggtggggacttgagcgcctgtgaagttgcctatttgatggaccatgagtgggcg
cgcacggcggaggacgtgctgtggcgccgcaccaagctggggcttcggctgagtgaatcc
gaggcggcggcgctggagacgtggatggccgcgcgcaatgcaagcggcgccaccggcgcg
cgcggtgacgacggcgatatcaagaccgcgaacgcggtctga

DBGET integrated database retrieval system