KEGG   Breoghania sp. L-A4: D1F64_22750Help
Entry
D1F64_22750       CDS       T05594                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
brn  Breoghania sp. L-A4
Pathway
brn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
brn01100  Metabolic pathways
brn01110  Biosynthesis of secondary metabolites
brn01130  Biosynthesis of antibiotics
brn01230  Biosynthesis of amino acids
Module
brn_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:brn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    D1F64_22750
Enzymes [BR:brn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     D1F64_22750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 AAA AAA_16 CoaE AAA_28 AAA_22 TsaE dNK AAA_5 AAA_14 RsgA_GTPase PduV-EutP
Motif
Other DBs
NCBI-ProteinID: AXS42290
UniProt: A0A346R731
LinkDB All DBs
Position
complement(4977108..4977689)
Genome map
AA seq 193 aa AA seqDB search
MHDRDPDRLRERLGARSIVLVGMMGCGKTSVGRQLAARLKIPFVDADHEIEEAANLTVPE
IFARHGEDYFRAGERRVIARLLGQPPRVLATGGGAFMNAQTRANIAERGVSVWLKGDFET
LFARVSRRTSRPLLQNPDPEGVMRKLLAERDPVYAQADVTVISRDVPHEVIVDEILAGLD
DYFAAHPEAGPAI
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgcacgatcgcgacccggaccggttgcgggagcgcctcggcgcgcgctcgatcgtgctc
gtcggcatgatgggctgcggcaagaccagtgtgggacgccaattggccgcgcggctgaag
atccccttcgtcgacgccgatcacgaaatcgaggaagccgccaatctgaccgtaccggag
atcttcgcccgtcacggcgaggactatttccgcgccggagaacggcgggtcatagcccgt
ctgctcggacagccgccccgggtgctggcgaccggcggcggcgccttcatgaacgcgcag
acgcgcgccaatattgccgaacgcggcgtatccgtttggctgaagggggatttcgagacc
cttttcgcacgcgtcagccgcaggacgtcgcgtccgctgttgcaaaatccggatccggaa
ggtgtcatgcgcaagctgcttgcggaacgcgatccggtctacgcgcaagccgatgtcacg
gtgatctcgcgcgatgtgccgcacgaggtcatcgtcgacgagatcctggcggggctggat
gactatttcgcggcgcatcccgaggccggccccgcgatctga

DBGET integrated database retrieval system