KEGG   Bradyrhizobium sp. ORS 285: BRAD285_0888Help
Entry
BRAD285_0888      CDS       T04956                                 

Gene name
aldB
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bro  Bradyrhizobium sp. ORS 285
Pathway
bro00010  Glycolysis / Gluconeogenesis
bro00620  Pyruvate metabolism
bro01100  Metabolic pathways
bro01110  Biosynthesis of secondary metabolites
bro01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRAD285_0888 (aldB)
   00620 Pyruvate metabolism
    BRAD285_0888 (aldB)
Enzymes [BR:bro01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BRAD285_0888 (aldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: SMX56145
UniProt: A0A1Y6K8T7
LinkDB All DBs
Position
909904..911421
Genome map
AA seq 505 aa AA seqDB search
MTKVDVHAALKPPFAARYDNFIGGAWKAPNAGKYFDNISPITGQPVCQIARSDASDIEAA
LDAAHAAKDGWARTSVTERALVLNKIADRMEANLAKLALAETWDNGKPIRETTAADIPLA
IDHFRYFAGVIRAQEGSIAEIDHDTIAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALAA
GNCVVMKPAEQTPASIMVWMELIGDLLPAGVLNVVNGFGLEAGKPLASSPRIAKIAFTGE
TSTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVCAEDDDFLDKAIEGFVMFALNQGEVC
TCPSRALIHESIYERFMERALKRVGAIVQGSPLDPATMIGAQASSEQLNKILSYIDIGRN
EGAQLLIGGERNVLGGDLAGGYYVKPTVFKGHNKMRVFQEEIFGPVVSVTTFKTEEEALA
IANDTLYGLGAGVWSRDANTCYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGVGRETH
KVMLDHYQQTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggttgacgtccatgcggcgctcaagccgcctttcgctgcgcgttacgacaac
ttcatcggtggcgcctggaaggccccgaacgcgggcaaatatttcgacaacatctcgccg
atcaccggccagccggtgtgccagatcgcgcgctccgatgcgtccgacatcgaggccgca
ctcgatgcggcgcatgccgccaaggatggctgggcgcgcaccagcgtcaccgagcgggcg
ctggtcctcaacaagatcgccgatcgcatggaggccaatctcgccaagctggcgctcgcc
gagacctgggacaatggcaagccgatccgcgagaccaccgccgccgacatcccgctcgcg
atcgatcatttccgctactttgccggcgtgatccgcgcccaggaaggctcgatcgccgag
atcgatcacgacaccatcgcctatcacttccacgagccgctcggcgtcgtcggccagatc
attccctggaacttcccgatcctgatggcggcgtggaagctcgcgcccgcgctcgcggcc
ggcaactgcgtcgtgatgaagccggcggagcagaccccggcctcgatcatggtctggatg
gagctgatcggcgacttgcttccggccggcgtgctcaacgtcgtcaacggcttcggcctc
gaggccggcaagccgctggcctcatcgccgcgcatcgccaagatcgccttcaccggcgag
acctcgacgggccggctgatcatgcaatacgcctcgcagaacctgatcccggtaacgctc
gagctcggcggcaagtcgccgaacatcttcttcaaggatgtctgcgccgaggatgacgac
ttcctcgacaaggcgatcgaaggcttcgtgatgttcgcgctcaaccagggcgaggtctgc
acttgcccgagccgtgcgctcattcatgaatcgatctacgaacgcttcatggagcgcgcc
ttgaagcgcgtcggcgcgatcgtgcagggcagcccgctcgatccggccaccatgatcggc
gcgcaggcctcgtccgagcagctcaacaagatcctgtcctacatcgacatcggcaggaac
gagggcgcgcagctgctgatcggcggcgagcggaacgtgctcggcggcgacctcgccggt
ggctactatgtcaagccgacggtgttcaagggccacaacaagatgcgcgtgttccaggag
gagatcttcgggcccgtcgtctcggtcacgaccttcaagaccgaggaggaggccttggcg
atcgccaacgacacgctttacggcctgggcgctggcgtgtggagccgcgacgccaacact
tgctaccgcttcggtcgcgcgatccaggccggacgcgtctggaccaactgctatcacgcc
tatccggcgcacgcagcgttcggcggctacaagcagtcgggcgtcggacgcgagacccac
aaggtgatgctggaccactatcagcagaccaagaacatgctggtcagctatagcccgaag
aagctcggcttcttctaa

DBGET integrated database retrieval system