KEGG   Bradyrhizobium sp. ORS 285: BRAD285_1482Help
Entry
BRAD285_1482      CDS       T04956                                 

Definition
(GenBank) putative ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bro  Bradyrhizobium sp. ORS 285
Pathway
bro03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bro00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BRAD285_1482
Enzymes [BR:bro01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BRAD285_1482
DNA repair and recombination proteins [BR:bro03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BRAD285_1482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase BNIP3
Motif
Other DBs
NCBI-ProteinID: SMX56670
UniProt: A0A1Y6KF44
LinkDB All DBs
Position
1410027..1412750
Genome map
AA seq 907 aa AA seqDB search
MALKKLSTYRKKRDFEKTAEPSGDAKVAPAARPRFVIHKHDATRLHYDLRLEFGGVFKSW
AVTKGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPEGEYGGGTVMLWDRGYWESEDPERGF
KKGDLKFTLEGEKLHGSWVLVRMRNDRTGGKRTNWLLIKHRDEFAREGEANDIIEADKSV
ASGRSMEQIAAGKGKAPKPFMLAKTQRMDADAVWHSNRSEGEAKSKVSTKASSPKAGAAK
GSAAKGSTAKPRATKTAEPKTVASLPDFVPPELCTSVAAPPSGEGWAHEIKFDGYRVQIR
VEDGQATLKTRKGLDWTAKFGAIAQAAAKLPDAIIDGEIVALDKDGNPNFSALQAAISAG
QTDELVFFAFDLMFVEEFDLRRQPLRERKARLAKLLKANIKGKTPRIRYVEHFESDGEAV
LDSARKLNLEGIVSKKLDSAYHSGRTESWTKAKTRPGHEVVIGGWKTTNGKFRSLMVGVN
KDDHLAYVGIVGTGFGQDTVKEIMPALKAAAAEKSPFSGKNAPRGAREVHWLKPELVAEI
EFAGFTGDGNVRQASFKGLRQDKPAREVVAEEPVVEAKVTKPVARAAATVATGGTTVHKT
PSRSKSSAMVMGVAISKPDKALWPDAGDGEPVTKLDLANYLEAVGDWMIDHIKGRPCSIV
RAPDGIGGERFFQRHGMQGMSDLLELVKVSGDRKPYLQIDRVEGLIAVAQVAAVELHPWN
CAPDAYDVPGRLVFDLDPAPNVAFEEVIAAAKEMRQRLKTLGLESFCKTTGGKGLHVVTP
LLHGARDKVTWPEAKAFAQGVCQWMANDSPDDYLLNMSKKLRKGKIFLDYLRNDRMSTAV
AVLSPRAREGATVSMPITWAQVKNGLDPKRYTVRTVPGLLAKTKAWDGYDDAAGAIKPAI
KKLTDKL
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctcaagaagctttccacctaccgcaagaagcgcgatttcgaaaaaacggcagag
ccgtccggcgatgccaaggtcgcgcccgcagcgcggccgcgcttcgtgatccacaagcac
gatgcgacacgactgcactacgatctcaggctggaattcggcggcgtcttcaagtcgtgg
gcggtaaccaagggtccgtcgctcgatccgcacgacaagcggctcgcggtcgaggtcgag
gaccatccgctggactacggcgatttcgaaggcaccattcccgaaggcgaatatggcggc
ggcacggtgatgctctgggaccgcggctattgggagagcgaagatcccgaacgcggcttc
aagaagggcgacctgaagttcacgctggaaggcgagaagctgcatggcagctgggtgctg
gtgcggatgcgcaacgaccgaaccggcggtaagcgcaccaattggctgctgatcaagcat
cgcgacgagttcgccagggaaggcgaggccaacgacatcatcgaggccgacaagtcggtc
gcgtcgggacgctcgatggagcagatcgcggccggcaagggcaaggccccgaagccgttc
atgctggccaagacgcagcgcatggatgccgacgcggtgtggcactcgaaccgcagcgaa
ggtgaagcgaagtcgaaggtttcgaccaaggcctcatcgccgaaggccggggcggcaaag
gggagcgctgccaaggggagcactgcaaagcctcgcgctacgaagacggccgagccgaag
accgtcgcgtcgctgccggacttcgtgccgcccgagctctgcacctctgtcgcggcgccg
ccgagcggcgaaggctgggcgcacgagatcaagttcgacggctatcgcgtgcagatccga
gtcgaggacggccaggcgaccttgaagacgcgcaagggtctcgactggaccgcaaagttc
ggcgcgatcgcgcaagccgcggccaagctgccggatgcgatcatcgatggcgagatcgtc
gcgctcgacaaggacggcaatccgaacttctccgcgctgcaggccgcgatctcggccggc
cagactgacgagctggtgttctttgccttcgacctgatgttcgtcgaggagttcgacctg
cgtcgtcagccgcttcgtgagcggaaggcacgccttgcgaagctgctgaaggcgaacatc
aagggcaagacacctcgcatccgctatgtcgagcatttcgagagcgatggcgaggcggtg
ctggactcggcgcgcaagctgaacctcgaaggtatcgtctcgaagaagctggattccgcc
tatcattccggacgcaccgagagctggaccaaggccaagacaaggcccggccacgaggtg
gtcattggtggctggaagaccaccaacggcaaattccgctcgctgatggtcggcgtcaac
aaggatgatcacctcgcttatgttggcattgtcggcaccggcttcggccaggacacggtg
aaggagatcatgccggcgctgaaggcggcggcggccgagaagagtccgttcagcggcaag
aacgcgccgcgtggggcgcgcgaggtgcattggctcaagcctgaactggtggccgagatc
gagttcgccggctttaccggagacggcaacgtcaggcaggcgtcgttcaagggactgcgt
caggacaagccggcgcgcgaggtcgtcgctgaggagccggttgtcgaggccaaggtgacg
aagccggtggcgcgcgccgcggccacggtggcgaccggagggacgacggtgcacaagaca
ccgtcgcgatccaagagttcggcgatggtcatgggcgtcgcgatctcgaagcctgacaag
gcgctgtggccggacgccggcgacggtgagcccgtgaccaagctcgacctcgccaactat
ctggaagccgtcggcgactggatgatcgatcatatcaaggggcggccgtgctcgatcgtg
cgtgcgccggacggcatcggcggcgagcggttttttcagcgccacggcatgcagggcatg
tccgatctgctcgaactggtgaaggtgtccggtgatcggaaaccctatctgcagatcgat
cgcgtcgagggactgatcgcagtggcgcaggtcgccgcggtcgagctccatccgtggaat
tgcgcgcccgatgcgtatgatgtgccgggacgcctggtgttcgatctcgatccggcgccg
aacgtcgccttcgaggaggtgatcgctgcggccaaggagatgcggcagcggctgaagacg
cttggcttggagagcttctgcaagaccaccggaggcaagggcctgcacgtcgtgacgccg
ctactgcatggcgcgcgcgacaaggtgacatggccggaagcgaaggcgtttgcgcagggg
gtgtgccaatggatggccaatgacagccccgacgactacctgctcaacatgtcgaagaag
ctgcgcaagggaaagatcttcctcgactatctgcgcaacgaccggatgtcgaccgcggtc
gcggtgctgtcgccgcgggcgcgtgagggcgcgacggtgtcgatgccaatcacctgggcg
caggtgaagaatgggctcgatcccaagcgctacacggttcgcaccgtgccggggctgctc
gcgaaaaccaaggcgtgggacggttacgatgatgcggccggagcgatcaagccggcgatc
aagaagctgacggacaaactgtaa

DBGET integrated database retrieval system