KEGG   Bradyrhizobium sp. ORS 285: BRAD285_3294Help
Entry
BRAD285_3294      CDS       T04956                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (E2) (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bro  Bradyrhizobium sp. ORS 285
Pathway
bro00010  Glycolysis / Gluconeogenesis
bro00020  Citrate cycle (TCA cycle)
bro00620  Pyruvate metabolism
bro01100  Metabolic pathways
bro01110  Biosynthesis of secondary metabolites
bro01120  Microbial metabolism in diverse environments
bro01130  Biosynthesis of antibiotics
bro01200  Carbon metabolism
Module
bro_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRAD285_3294 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BRAD285_3294 (pdhC)
   00620 Pyruvate metabolism
    BRAD285_3294 (pdhC)
Enzymes [BR:bro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BRAD285_3294 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N QRPTase_N Fas_alpha_ACP Neisseria_TspB BASP1
Motif
Other DBs
NCBI-ProteinID: SMX58294
UniProt: A0A1Y6KFB0
LinkDB All DBs
Position
3252280..3253638
Genome map
AA seq 452 aa AA seqDB search
MPINILMPALSPTMEKGNLARWLKKEGDQVKSGEVIAEIETDKATMEVEAVDEGTLAKIL
VPEGTQDVPVNDVIAVLAGEGEDVKAAGGAPAAAAPAAEAKPTASAAPAAAPAPAAAPAP
KPAAAPAPAAPAAAAPQVNGHERIFSSPLARRLAKDAGIDLGRITGTGPHGRVVARDVEE
AKSGKGLKAAPTAAPAAGGAPAVAPSMSDKQILALFEPGSYEVIPHDGMRRTIAQRLTAA
TQTVPHFYLTIDCDIGKLLAAREEINAAAPKDKEKKPLYKLSVNDFVIKAMAVALQKIPN
CNVSWTEGGMVKHKHSDVGVAVAMPGGLITPIIRKAETKTLSAISNEMKDFAARARSRKL
KPEEYQGGTTAVSNLGMYGITHFTAVINPPHATILAVGTSEERPVVRNGKIEIASMMSVT
LSCDHRAIDGALGAELIGAFKQLIENPVMMMV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacattctgatgcccgcgctgtcgccgacgatggagaagggcaacctcgct
cgttggctcaagaaggaaggcgaccaggtcaagtcgggcgaggtcatcgccgagatcgag
accgacaaggccacgatggaagtcgaggcggtcgacgaaggcacgctcgccaagatcctg
gtgcccgagggcacgcaggacgtcccggtcaacgacgtgatcgcggtgctcgccggtgag
ggcgaggacgtgaaggccgcgggcggcgcgccggcggccgctgcgccggcggccgaagcc
aagccgacggcgtctgcggcccccgccgctgcgccagcacctgctgccgcgcccgcgccg
aagccggctgcggctcccgcgccagccgctcctgcggctgctgccccccaggtcaatggt
cacgagcgcatcttctcgtcaccgctggcgcggcgccttgccaaggatgccggcatcgat
ctcggccgcattacgggcaccggcccgcatggccgcgtcgtcgcgcgcgacgtcgaggag
gccaagtctggcaagggcctgaaggccgcgccgacggctgctcccgctgccgggggcgcg
ccggccgtggcgccatcgatgtcggacaagcagatcctggcgctgttcgagccgggctcc
tacgaggtcatcccgcatgacggcatgcgccgtaccatcgcgcagcgcctcaccgcggcg
acgcagaccgttccgcatttctatctcacgatcgactgcgacatcggcaagctcttggct
gcgcgtgaggagatcaatgcggctgcgccgaaggacaaggagaagaagccgctctacaag
ctctcggtgaacgacttcgtcatcaaggcgatggcggtggcgctgcagaagatcccgaac
tgcaacgtcagctggaccgaaggcggcatggtcaagcacaagcattccgacgtcggcgtt
gccgtggcgatgccgggcggcctgatcaccccgatcatccgcaaagccgagaccaagacg
ctgtcggcgatctcgaacgagatgaaggactttgccgcgcgcgcccgctcgcgcaagctg
aagccggaggaatatcagggcggcaccaccgccgtgtcgaacctcggcatgtacggcatc
acgcacttcaccgcggtgatcaacccgccacatgcgacaatccttgcggtcggcacatca
gaggagcgacccgtcgtgcgcaacggcaagatcgagatcgccagcatgatgagcgtgacc
ctgtcgtgtgaccaccgcgccatcgacggcgcgctcggcgccgagctgatcggcgccttc
aagcagctgatcgagaaccccgtgatgatgatggtgtga

DBGET integrated database retrieval system