KEGG   Bradyrhizobium sp. ORS 285: BRAD285_4512Help
Entry
BRAD285_4512      CDS       T04956                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase A (D-alanylalanine synthetase A) (D-Ala-D-Ala ligase A)
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bro  Bradyrhizobium sp. ORS 285
Pathway
bro00473  D-Alanine metabolism
bro00550  Peptidoglycan biosynthesis
bro01100  Metabolic pathways
bro01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BRAD285_4512 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BRAD285_4512 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BRAD285_4512 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bro01011]
    BRAD285_4512 (ddlA)
Enzymes [BR:bro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BRAD285_4512 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:bro01011]
 Precursor biosynthesis
  Amino acid ligase
   BRAD285_4512 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: SMX59377
UniProt: A0A1Y6KKX5
LinkDB All DBs
Position
4447509..4448537
Genome map
AA seq 342 aa AA seqDB search
MTDKKIRVAILFGGRSAEHDVSRASAANIFRSLDASRYAITLIGIAPDGRWVLADAANDA
PGTALTVPADGPAIVLLPAGQGRALVLGDGAPRELAFDVIFPVLHGPNGEDGTVQGALEL
ADVAYVGGRVMGSAAAMDKDVAKRLLRDAGLPIVPFVTMTEAAPVSYEAAVAAVGSSELF
VKPANLGSSVGISKARNADEFDAACKLALRFDRKILIERCISPAREIECAVLEHANGEVK
ASELGEIVPADSHGFYSYEAKYTDAKGASLHVPAQVEPALAARIRKMAVEVFSVLCCESL
ARVDVFVRGEEVYVNEVNTLPGFTNISMYPKCGKPPACPSRR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaagaagatccgcgtggcgatcctgttcggcggacgctcggcggagcacgac
gtctcccgggcctccgctgccaacatctttcgctcgctcgatgccagccgctacgcgatc
accttgatcggcatcgcccctgacggccgctgggtgcttgccgatgccgccaatgatgcg
cccggtacggcgctgaccgtgcctgccgacgggcccgccatcgtgctgctgcccgcgggc
cagggccgcgcgctggtccttggcgacggcgccccgcgcgagctcgctttcgatgtcatc
ttcccggtgctgcatggtcccaacggcgaggacggcaccgttcagggcgcgctggagctc
gccgatgtcgcctatgtcggcgggcgcgtgatgggatcggcggcggcgatggacaaggac
gtcgccaagcgtctgctgcgcgacgccggcctgccgatcgtgccgttcgtcacgatgacg
gaagcagcgccggtgagctacgaagcggcggtcgccgccgtcggctcttccgagctgttc
gtcaagccggccaatctcggctcctccgtcggcatctccaaggcgcgcaacgccgatgaa
ttcgatgcggcctgcaagcttgcgctgcgcttcgaccggaaaatcctgatcgagcgctgc
atctcgccggcccgcgagatcgaatgcgccgtgctggagcacgccaacggcgaggtcaaa
gcctccgagctcggcgagatcgtgccggccgacagccacggcttctactcctacgaggcg
aaatacaccgacgccaagggcgcctcgctgcatgtcccggcgcaggtcgagccggcgctc
gccgcgcgcatccgcaagatggcagtcgaggtgttcagcgtgctctgttgcgagagcctc
gcgcgcgtcgatgtcttcgtccgcggcgaggaggtctacgtcaacgaggtgaacaccctg
cccggcttcaccaacatcagcatgtacccgaaatgtgggaagccaccggcctgccccagc
cggcgctga

DBGET integrated database retrieval system