KEGG   Bradyrhizobium sp. ORS 285: BRAD285_4757Help
Entry
BRAD285_4757      CDS       T04956                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bro  Bradyrhizobium sp. ORS 285
Pathway
bro00620  Pyruvate metabolism
bro00680  Methane metabolism
bro00710  Carbon fixation in photosynthetic organisms
bro01100  Metabolic pathways
bro01120  Microbial metabolism in diverse environments
bro01200  Carbon metabolism
Module
bro_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BRAD285_4757 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BRAD285_4757 (ppc)
   00680 Methane metabolism
    BRAD285_4757 (ppc)
Enzymes [BR:bro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BRAD285_4757 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: SMX59600
UniProt: A0A1Y6KNK8
LinkDB All DBs
Position
complement(4701748..4704543)
Genome map
AA seq 931 aa AA seqDB search
MSPQAIQDVMPEEIRPNRAAEAQAMEEDARLRDDIRLLGRILGDTVRDQEGADVFDLVEL
IRQTSVRFHRDEDRQARGELEQILDGMTTAETVRIVRAFSYFSHLANIAEDQNNIRRMRA
KSDGNGGAGMLAATLAHAKSAGFEAAELRKFFSTALVSPVLTAHPTEVRRKSTMDREMEV
AMLLDRRERMQLTPDEREANDEALRRAVLTLWQTNLLRRTKLTVLDEVTNGLSFYDYTFL
REVPRLLCSLEDRLNDGAEVAGDLASFLRMGSWIGGDRDGNPFVTAEVMRGTLKLQSSLA
LHYYLEELHLLGSELSMAAHLADVSEELRVLAERSPDTSPHRSGEPYRLAVSGIYARLAA
TAKKLGIQISRLPVAAVAPYDSVKQLQDDLDVLHRSLIANNAEVIARGRLRMLRRAVDCF
GFHLARLDIRQNSAVHERTVAELIDTAMPGMSYMALSEDARVGLLVSELRNNRPLVSQFV
KYSDETVGELDLFRAAAEAHATFGADVISQCIISMCKGMSDMLEVALLLKEVGLIDPSGR
CAVNIVPLFETIEDLQASSGIMDRMLALHDYRRLVDSRGAVQEVMLGYSDSNKDGGFVTS
GWELYKAEIGLVDIFERHGIRLRLFHGRGGSVGRGGGPSYDAIIAQPGGAVNGQIRITEQ
GEIISSKYSNAEVGRTNLEILAAATLEASLLHPRQPAPKREYLTAMDRLSELAFKAYRGL
VYETDGFVDYFWASTVINEIATLNIGSRPASRKKTRAIEDLRAIPWVFSWAQCRLMLPGW
YGFGSAVETWIAENPDQGMPFLRELNREWPFFRMLLSNMDMVLAKSSIAIASRYAELVPD
EALREKIFGRIRGEWNLVIETLLDITGQERLLQGNPLLERSVRNRFPYLDPLNHVQVELL
KAHRAQNPDEQVLRGIQLTINGISAGLRNTG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgcaagccatacaagatgtcatgccagaggaaatccgtcccaaccgcgccgcc
gaggcgcaagccatggaggaggatgcgcggctccgtgacgacatccggctgctcggccgc
attctcggcgacaccgtccgcgaccaggagggcgctgatgtgttcgacctggtcgagctg
atacgccagacgtcggtgcgcttccacagggacgaggatcggcaggcgaggggcgagctg
gagcagatcctcgacggcatgaccacggcggagaccgtccggatcgtccgcgccttcagc
tatttctcccacctcgccaacatcgccgaggaccagaacaatatccgccgcatgcgcgcc
aagagtgatggcaatggcggcgccgggatgctggccgcgacgttggcgcacgccaagtcg
gcgggcttcgaggccgccgagctgcgcaagttcttctcgaccgcgctcgtcagtccggtg
ctgaccgcgcatccgaccgaggtgcggcgcaagagcacgatggatcgcgagatggaggtg
gcgatgctgctcgaccgccgcgagcggatgcagctgaccccggacgagcgcgaagccaat
gacgaggcgctgcgccgcgcggtgctgaccctgtggcagaccaatctgctgcgccggacc
aagctgaccgtgctcgacgaggtcaccaacgggctgtcgttctacgactacaccttcctg
cgcgaggtgccgcggctgttgtgcagcttggaggaccggctgaacgacggcgccgaggtc
gcgggcgacctcgcgtcgttcctgcgcatgggcagctggatcggcggcgaccgcgatggc
aatccgttcgtcaccgccgaggtgatgcgcggcacgctgaagctgcagtcgagcctggcg
ctgcactactatcttgaagagctgcatctgctcggcagcgagctgtcgatggcggcccat
ctcgccgatgtctccgaggagctgcgtgtgctcgccgagcgctcccccgacacgtcgccc
catcgcagcggcgagccgtatcggctggcggtgtccggcatctacgcgcgcctcgcagcc
accgcgaaaaagctcggcatccagatcagccgcctgccggtggcggcggtcgcgccctat
gacagcgtcaagcagctgcaggacgatctcgacgtgctgcatcgttcgctgatcgccaac
aatgccgaggtgatcgcgcgcggccgcctgcggatgctgcggcgtgcggtcgactgcttc
ggcttccatctggcgcggctcgacatccgccagaactcggcggtgcacgagcgcacggtg
gccgagctgatcgacaccgcgatgcccggcatgtcctacatggcgctgagcgaggatgcg
cgcgtcggcctgctggtgagcgagctgcgcaataacaggccgctggtgtcgcaattcgtc
aagtacagcgacgagacggtcggcgagctcgacctgttccgtgccgccgcagaggcgcac
gcgacgttcggcgccgacgtgatttcccagtgcatcatctcgatgtgcaagggcatgtcg
gacatgctggaggtcgcgctgctgttgaaggaggtcgggctgatcgatccctccggtcgc
tgcgctgtcaacatcgtgccgctgttcgagaccatcgaggatctgcaggcctccagcggc
atcatggaccggatgctggcgctgcacgattatcgccgcctcgtcgacagccgcggcgcc
gtgcaggaggtcatgctcggctattccgacagcaacaaggacggcggcttcgtcacctcg
ggctgggagctctacaaggccgagatcgggctggtcgacatcttcgagcgccacggcatt
cggctccggctgttccacggtcgcggcggttcggtcggccgcggcggcggcccgagctat
gacgccatcatcgcgcagcccggcggcgccgtgaacggccagatccgcatcaccgagcag
ggcgagatcatctccagcaaatattcgaacgccgaagtcggccgtactaatctggagatc
ctggcggcggcgacgctcgaggccagcctgctgcatccgcggcagccggcgccgaagcgc
gaatatctcaccgcgatggacaggctctccgagctcgccttcaaggcctatcgcggcctg
gtctacgagaccgacggcttcgtcgactatttctgggcctcgactgtcatcaacgagatc
gcgaccttgaacatcggcagccgtccggcctcgcgcaagaagacccgcgcgatcgaggat
ctgcgcgcgatcccctgggtgttctcctgggcgcagtgccggctgatgctgccgggctgg
tacggcttcggcagcgcggtcgagacctggatcgcggaaaatccggaccagggcatgccg
ttcctgcgcgagctcaatcgcgagtggccgttcttccgcatgctgctgtcgaacatggac
atggtgctcgccaagagctcgatcgcgatcgcctcgcgctatgcggaactggtgcccgac
gaggcgttgcgcgaaaagatcttcggccgcatccgcggtgaatggaatctcgtgatcgag
actctgctcgacatcaccggccaggagcggctgttgcagggcaacccgctgctggagcgc
tcggtgcgcaaccggtttccgtatctcgatccgctcaaccacgtccaggtcgagctcttg
aaggcgcaccgcgcgcagaatccggacgagcaggtgctgcgcgggattcagctgaccatc
aacggcatctcggcggggttgaggaatacggggtag

DBGET integrated database retrieval system