KEGG   Bradyrhizobium sp. ORS 285: BRAD285_5133Help
Entry
BRAD285_5133      CDS       T04956                                 

Definition
(GenBank) acetyl CoA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
bro  Bradyrhizobium sp. ORS 285
Pathway
bro00061  Fatty acid biosynthesis
bro00620  Pyruvate metabolism
bro00640  Propanoate metabolism
bro01100  Metabolic pathways
bro01110  Biosynthesis of secondary metabolites
bro01120  Microbial metabolism in diverse environments
bro01130  Biosynthesis of antibiotics
bro01200  Carbon metabolism
bro01212  Fatty acid metabolism
Module
bro_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BRAD285_5133
   00640 Propanoate metabolism
    BRAD285_5133
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BRAD285_5133
Enzymes [BR:bro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BRAD285_5133
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BRAD285_5133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATP-grasp_5 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: SMX59954
UniProt: A0A1Y6KK33
LinkDB All DBs
Position
complement(5131670..5133052)
Genome map
AA seq 460 aa AA seqDB search
MTLRSVLIANRGEIAVRIIRAAKALGLRSVLAHSIADKDSLAAQLADETIEIGPPAAKKS
YLNIEAVLNAAKASKVDAVHPGYGFLAENAEFADAVTAAGIVFVGPSAEAIRLLGDKVMA
RQVAALAGVPTVPGSDGRVTALDEAIAIAARIGFPVMIKAAAGGGGRGIRIVGDAEEFAR
QFPQASSEAAAAFGDGGLYIEKVIERARHVEVQILGDGTDVVHCYERECSLQRRRQKVWE
EAPAVGLPDDVRQRLCASAVALGRAVGYSGAGTVEYLYDDATSEFYFIEVNTRIQVEHPV
TEMITGIDLVQEMLKIAGGARLSVTQDDVCIQGHAIECRINAEDPHQGFMPAPGTIERLV
VPEGEGIRFDTLLFEGYAVPPFYDSLLGKLIVRGETRADCLARLREALDGLAISGIPTTI
PLHAALARDASVADGRTHTRFLEPWLETDFAQLARAREDA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaccctccgctcggtcctgatcgccaaccggggcgagatcgcggtgcgcatcatccgc
gcggcgaaggcgctcggcttgcgcagcgtgctcgcgcacagcatcgcggacaaggactcg
cttgccgcccagcttgccgacgagacaatcgagatcgggccaccggccgcgaagaaatcc
tatctcaacatcgaggccgtgttgaacgcggccaaggcgtccaaggtcgacgcggtgcat
cccggctacggcttccttgcagagaatgccgagttcgccgacgccgtcaccgcggccggt
atcgtcttcgtcggcccgagcgcggaagcgatccggctgctgggtgacaaggtgatggcg
cgccaggtcgcggcgctcgccggtgtgccgaccgtgccgggctcggacggccgcgtcacc
gcgctcgacgaagcgatcgccatcgctgcgcggatcggctttcccgtgatgatcaaggcg
gccgccggcggtggcgggcgcggcatccgcatcgtcggcgatgccgaagagttcgcgcgg
cagtttccgcaggcgtcgagcgaggcggcggccgccttcggcgatggcgggctttatatc
gagaaggtcatcgagcgcgcgcgccatgtcgaggtgcagatcctgggcgacggcacggac
gtcgtgcattgctacgagcgcgaatgctcgctgcagcggcggcggcagaaggtgtgggag
gaggcgccagcggtcgggctgccggacgacgttcgccagcggctctgcgccagcgccgtc
gcactcggccgcgccgtcggctacagcggcgccggcaccgtcgaatatctctacgacgat
gcgaccagcgaattctacttcatcgaggtcaatacccgtatccaggtcgagcatcccgtc
accgagatgatcaccggcatcgacctggtgcaggagatgctgaagatcgccggcggcgcc
aggctgtcggtgacacaggacgacgtctgtatccagggccacgccatcgagtgccggatc
aatgccgaggatccgcaccagggcttcatgccggcacccggcacgatcgaacggctcgtc
gttcccgagggcgagggcatccgcttcgataccttgctgttcgaaggctatgccgtgccg
ccgttctacgactcgctgctcggcaagctgatcgtgcgcggcgagacccgcgccgattgc
ctggcccgtcttcgcgaggcgctcgatggcctcgcgatatcaggcatccccaccaccatt
ccgctgcatgcggcgctggcgcgcgatgccagcgtcgctgatggccgtacccatacccgc
ttcctcgagccatggctcgagaccgattttgcgcagctggcccgcgccagggaggacgcc
tga

DBGET integrated database retrieval system