KEGG   Bradyrhizobium sp. ORS 285: BRAD285_5386Help
Entry
BRAD285_5386      CDS       T04956                                 

Gene name
glpD
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase FAD/NAD(P)-binding (aerobic)
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bro  Bradyrhizobium sp. ORS 285
Pathway
bro00564  Glycerophospholipid metabolism
bro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BRAD285_5386 (glpD)
Enzymes [BR:bro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BRAD285_5386 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 FAD_binding_3 Pyr_redox FAD_oxidored Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: SMX60193
UniProt: A0A1Y6KKQ4
LinkDB All DBs
Position
complement(5383288..5384832)
Genome map
AA seq 514 aa AA seqDB search
MERIYDLAIIGGGVNGCGIARDAAGRGNSVFLCEMNDLASGTSSWSTKLVHGGLRYLEYY
EFRLVREALIEREILWQIAPHIIRPLRFVLPHHSGLRPAWLLRLGLFLYDHLGGRKLLPP
TRSVNLRSDEVGRPLIPGRYATGFEYSDCFVDDARLVVLTARDAADRGAEIRTRTRATEI
RQDGNVWLVTTENTQTGERETIKARALVNAAGPWVEQVLSTGAGVNAKAKVRLVQGSHIV
VRKLYDHDRAYIFQNADGRIIFAIPYQQDFTLIGTTDRDYQGDPAKVKATDEEIAYLCAA
LGEYIAKPVTPADVVWSYSGVRPLYDDGASEAKAATRDYVFELDTPGGLPLLSIYGGKIT
TYRRLSEEALERLAPYLKGAKAEEGWTGKATLPGGDMKVQAVSTLIADISKTYPFLADAH
AKRIAHAYGTRAKTMLAGATSSADLGQDFGGTLTEREVRYLMTNEWALTAEDIVWRRSKL
GLRMSAAEIAALDAWIIANRERAAATAREAGGRA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
ttggagcggatctacgacctcgccattatcggaggcggcgtgaacggctgcggcatcgcg
cgcgatgcggccggacgcggaaattccgttttcctgtgcgaaatgaacgatctggcgagc
ggaacctcgtcctggtcgaccaagctcgtgcacggcggcctgcgctatctcgaatattac
gagtttcgcctcgtgcgcgaggcgctgatcgagcgcgagatcctgtggcagatcgcgccc
cacatcatccgtcccttgcgcttcgttctgccgcatcattcgggccttcgcccggcgtgg
ctgctgcgcctcggtcttttcctctacgaccatctcggtggccgcaagctgctgccgccg
acccggtcggtgaacctgcgcagcgacgaggtcggccgtccgctgatccccgggcgctac
gccaccggcttcgaatattccgattgcttcgtcgacgatgcccgccttgtcgttctgacc
gcgcgtgacgctgccgatcgtggtgccgagatccgcacgcgtacgcgtgccaccgagatc
cgccaggacggcaacgtctggctggtgacgaccgagaatacccagacaggagagcgcgag
accatcaaggcgcgcgcgctggtcaatgccgccgggccgtgggtcgagcaggtgctgtcg
accggcgccggcgtgaatgcgaaggccaaggtgcgcctggtgcagggctcgcacatcgtt
gtgcgcaagctgtacgatcacgaccgtgcctacatcttccagaacgccgacggccgcatc
atcttcgccattccttatcagcaggatttcacgctgatcggcaccacggatcgcgactac
cagggcgatccggccaaggtgaaggcgaccgacgaggagatcgcctatctctgcgcagcg
ctcggcgaatacattgccaagccggtgacgccggccgacgtcgtgtggagctattccggc
gtgcgtccgctgtatgacgacggcgccagcgaagccaaggcggcgacgcgcgactatgtc
ttcgagctcgatacgcccggcggtctgcccttgctgtcgatctatggcggcaagatcacc
acctatcggcggctgtcggaagaggcgctcgagcgtctcgcgccctatctgaaaggcgcc
aaggcggaagagggctggaccggcaaggcgacgttgcccggtggcgacatgaaggtgcag
gccgtcagcacgctgatcgcggatatcagcaagacctatccgttcctggccgatgcacat
gcgaagcgcatcgcacatgcctatggcacgcgggccaagaccatgctcgcgggtgcgaca
tcttcggccgatctcggccaggatttcggtggcaccttgacggagcgtgaagtccggtac
ctgatgacgaacgagtgggcgttgacggccgaggacatcgtgtggcggcgatcgaagctg
gggttgcggatgtcggcggctgagatcgccgcgcttgatgcatggatcatcgccaaccgc
gagcgcgcggccgcgacggcgcgtgaagccgggggacgcgcatga

DBGET integrated database retrieval system