KEGG   Bradyrhizobium sp. ORS 285: BRAD285_5741Help
Entry
BRAD285_5741      CDS       T04956                                 

Gene name
cbbS
Definition
(GenBank) Ribulose bisphosphate carboxylase small chain (RuBisCO small subunit)
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
bro  Bradyrhizobium sp. ORS 285
Pathway
bro00630  Glyoxylate and dicarboxylate metabolism
bro00710  Carbon fixation in photosynthetic organisms
bro01100  Metabolic pathways
bro01120  Microbial metabolism in diverse environments
bro01200  Carbon metabolism
Module
bro_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bro_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
bro_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:bro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BRAD285_5741 (cbbS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BRAD285_5741 (cbbS)
Enzymes [BR:bro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BRAD285_5741 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: SMX60526
UniProt: A0A1Y6KLS3
LinkDB All DBs
Position
complement(5749489..5749908)
Genome map
AA seq 139 aa AA seqDB search
MRVTQGCFSFLPDLTDDQITAQIQYCLEKGWAVNIEFTDDPHPRNTYWEMWGLPMFDLRD
AAGIMRELAECRKIYGDRYIRISAFDSSHGWESIRLSFIVNRPKNEPGFRLDRQETVGRN
QRYSTRSYAAERPEGERYS
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgacccaaggctgcttttccttcctgcccgatctgacggacgaccagatcacc
gcccagatccagtactgcctcgagaagggatgggcggtgaatatcgagttcaccgacgac
ccgcatccccgcaacacctattgggagatgtggggcctgccgatgttcgacctgcgcgat
gccgccggcatcatgcgggagcttgccgagtgccggaagatctatggcgaccgctacatc
cggatctcggcgttcgactcgtctcatggctgggagtcgatccggctgtccttcatcgtc
aaccggccgaagaacgagccaggcttccggctcgatcgtcaggaaaccgtcgggcgcaat
cagcgttactcgacgcggtcctacgcggccgagcggcccgaaggcgagcgctactcataa

DBGET integrated database retrieval system