KEGG   Bradyrhizobium sp. ORS 285: BRAD285_6791Help
Entry
BRAD285_6791      CDS       T04956                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bro  Bradyrhizobium sp. ORS 285
Pathway
bro00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BRAD285_6791 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bro02000]
    BRAD285_6791 (gst)
Enzymes [BR:bro01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BRAD285_6791 (gst)
Transporters [BR:bro02000]
 Other Transporters
  Pores ion channels [TC:1]
   BRAD285_6791 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_N_2 GST_N GST_N_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: SMX61455
UniProt: A0A1Y6KNY5
LinkDB All DBs
Position
6820020..6820634
Genome map
AA seq 204 aa AA seqDB search
MKLYYSPGACSLSPHIALLEAGLPYDLVKVDLRAKTLENGDDYLKVNPKGQVPALGLPSG
EIVTEGPVIVQMIADQAAGKGLAPARDSGERYKLLEWLNFITSELHKNFGPMFSPVLADD
AKAFFKDRVMGKFKYIDSQLAGRDYLMGNQFTVADGYLFTILTWAERMKFDLSGMPNLVA
YKNRVAARPKVQEALTKEGLMKAG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttattattcacccggcgcctgctcgctgtcgccccatatcgccctgctcgag
gcgggcctgccctacgatctggtgaaggtcgatctgcgcgccaagaccctggaaaatggc
gacgattatctcaaggtcaatccgaagggccaggtgcccgccctggggctgccgagcggc
gaaatcgtgaccgagggtccggtcatcgtccagatgatcgccgaccaggcggcgggcaag
ggcctggcgccggcgcgcgacagcggcgagcgctacaagctgctggagtggctcaacttc
atcacgtccgagctgcacaagaatttcggcccgatgttctcaccggtgctcgccgacgac
gccaaggcgttcttcaaggaccgcgtgatgggcaagttcaagtacatcgacagccagctc
gccggccgcgactacctgatgggcaaccagttcacggtggccgacggctatttgttcacg
atcctgacctgggcggagcggatgaagttcgatctgtctgggatgccgaacctggtggcc
tacaagaaccgcgtagcggcccggccgaaggtgcaggaggcgctgacaaaggaagggctg
atgaaggcggggtaa

DBGET integrated database retrieval system