KEGG   Bradyrhizobium sp. ORS 285: BRAD285_7743Help
Entry
BRAD285_7743      CDS       T04956                                 

Definition
(GenBank) putative glycosyl hydrolase, 13 family; Maltose alpha-D-glucosyltransferase (trehalose synthase)
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bro  Bradyrhizobium sp. ORS 285
Pathway
bro00500  Starch and sucrose metabolism
bro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BRAD285_7743
Enzymes [BR:bro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BRAD285_7743
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BRAD285_7743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: SMX62305
UniProt: A0A1Y6KRD9
LinkDB All DBs
Position
complement(7757816..7759525)
Genome map
AA seq 569 aa AA seqDB search
MIDDLWYKNAVFYCLSVGTYMDADGDGIGDFKGLTRRLDYLHGLGITAIWLMPFQPSPQR
DDGYDVADYYNVDPRYGTLGDFVQFTHGCQQRGIRVIIDLVVNHTSDQHPWFLDARSSKD
SRHRDWYVWSDKKPANADKGMVFPGVQKTTWTRDKQAGAYYFHRFYDFQPDLNTANPEVQ
AEILKIMGFWIQLGVSGFRMDAVPFVIAAKGADIKKPLEQYDMLRTFREFLQWRQGEAII
LAEANVLPETDMEYFGDDGDRMHMMFNFHVNQHLFYALAASDTRPLAKALEATKPRPASA
QWGLFLRNHDELDLGRLTKEQRAAVFAAFGPDKSMQLYDRGIRRRLAPMLGGDRRRIELA
YSLMFTLPGTPVIRYGDELAMGDDLSLPERNCARTPMQWSAEPHGGFTKSETSASPVIDH
GPYGYDHVNAAKQRRDPNSMLNWTERIIRMRKEVPEIGWGDFAVIATKDPAVLIMRYDWR
NNSVLFVHNLDEKPRETSFDVGLPDEAGKLLINLLSEDHSQADDRGRHTLVLEPYGYRWY
RVGGLDYLLRRSDIETESPGKRVRKTRRR
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgatctctggtacaagaacgccgtgttctactgcctgtcggtcggcacctac
atggatgccgatggcgacggcatcggcgacttcaagggcctgacgcgccggctcgactat
ctgcacggcctcggcatcaccgcgatctggctgatgccgttccagccgtcaccacagcgc
gacgacggctatgacgttgcggattactacaacgtcgatccacgctacggcacgctcggg
gatttcgtgcagttcacccatggctgccagcagcgcggcatccgcgtgatcatcgacctc
gtcgtcaaccacacctccgaccagcatccatggtttctggacgcccgcagctccaaggac
tcgcgccatcgcgactggtatgtctggtcggacaagaagccggccaatgccgacaagggc
atggtgtttcccggcgtgcagaagacgacctggacgcgcgacaagcaggccggcgcctac
tatttccaccgcttctatgatttccagccggatctcaacacggcgaatccggaggtgcag
gccgagatcctgaagatcatgggattctggatccagctcggcgtctccggcttccgcatg
gatgcggtgccgttcgtgatcgcggccaagggtgccgacatcaagaaaccgctcgagcag
tacgacatgctccggacgttcagggaattcctgcaatggcgccagggcgaggcgatcatc
ctcgcggaagccaacgtcttgcccgaaaccgacatggaatatttcggcgacgacggcgat
cgcatgcacatgatgttcaacttccacgtcaaccagcacctgttctatgcgctcgccgcc
tcggatacccggccactcgccaaggcgctggaagcgaccaagccgcggccggcttcggcg
caatggggcctgttcctgcgcaatcacgacgaactcgatctcgggcggctgacgaaggag
cagcgcgcggcggtgttcgcggcgttcgggccggacaagagcatgcagctctacgaccgc
ggcatccgccggcggctggcgccgatgctcggcggcgaccgccgccgcattgagctggcc
tacagcctgatgttcactttgcccggcacgcccgtgatccgctacggcgacgagctcgcg
atgggcgacgatctcagccttcccgaacgcaattgcgcgcggacgccgatgcaatggtcg
gccgagccgcatggcggcttcaccaagagcgagacctcggcatcgcccgtgatcgatcac
gggccctatggctacgaccacgtcaacgccgccaagcagcgccgcgatccgaattcgatg
ctgaactggaccgagcgcatcatccgcatgcgcaaggaggtgccggagatcggctggggc
gattttgccgtgatcgcgacgaaagatcccgcggtgctgatcatgcgctatgactggcgc
aacaattcggtgctgttcgtgcacaatctcgatgagaagccgcgcgagaccagcttcgac
gtcggcctgcccgacgaggccggcaagctgctgatcaatctgctctccgaggatcacagc
caagccgacgaccgcggccgccacaccctggtgctggagccctacggctaccgctggtac
cgcgtcggcgggttggactacctgctgcggcggagcgacatcgagacggagagcccgggg
aaacgggttcggaagacgcggcggcggtga

DBGET integrated database retrieval system