KEGG   Brassica rapa (field mustard): 103829568Help
Entry
103829568         CDS       T03449                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00020  Citrate cycle (TCA cycle)
brp00190  Oxidative phosphorylation
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
brp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103829568
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103829568
Enzymes [BR:brp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103829568
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 103829568
NCBI-ProteinID: XP_009103489
UniProt: A0A397YPJ1
LinkDB All DBs
Position
A7
AA seq 626 aa AA seqDB search
MWRCVSRSLRVPSSRTSLSGSRFSRFLSTGSTGDYTIVDHTYDAVVVGAGGAGLRAAIGL
SEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQDAIQ
YMCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHAL
LHTLYGQAMKHNTQFFVEYFALDLLMASDGTCQGVIALNMEDGTLHRFRSAQTILATGGY
GRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGILR
NSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPHKDHIYLHLNHLPPEVLKER
LPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVVPGLMAA
GEAACASVHGANRLGANSLLDIVVFGRACANRVAEISKPGEKQRPLEENAGKKTIEWLNK
LRHSSGSLPTSSIRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFEDVQVKDRSLIW
NSDLIETIELENLLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEKV
RLEYRPVHMDTLDDEIDTFPPKARVY
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtctctcgtagccttcgtgttccttcctcaaggacctcgctctctgga
tctcgcttttccagattcctctccaccggttccacaggtgattacacgatagtggatcac
acctatgatgcggtggttgtgggagctggtggtgctgggcttagggcggccattggatta
tctgagcatggattcaacaccgcttgcatcaccaagctcttccccacacggtcacatacc
gtcgctgctcagggtggtattaatgctgcactgggaaacatgtctgaagatgactggaga
tggcatatgtatgatactgtcaaaggaagtgactggcttggtgatcaagatgccattcag
tatatgtgtagagaggcaccaaaagcagtgattgaacttgagaattatggtcttcccttt
tctcgtactgaagagggtaaaatttaccagcgtgcgtttggtggccagagtcttgacttt
ggcaaaggtggtcaggcctaccgttgtgcttgtgctgcggatcggactgggcatgctctc
ttgcataccttatatggacaagctatgaagcataacacacagttctttgttgaatacttc
gctctggatttgctcatggctagtgatggcacttgccagggagtaattgcactaaacatg
gaagatggaacattgcatcgtttccgctctgcacaaacaatcttggccactgggggttac
ggcagagcatacttctctgcaacctcagcacatacatgcacaggagatggcaatgcaatg
gttgcacgtgctggtcttccactccaggacttggagtttgttcagttccatccaactggt
atttatggagccggatgtctcatcactgaaggatcccgaggtgaaggtggtatccttaga
aacagtgaaggtgaacgttttatggaacgatatgctcctacagccaaggatcttgcatca
agagatgttgtctctagatctatgactatggaaattagggaaggtcgtggtgtaggaccg
cataaggatcatatctatctccatttgaaccatctcccaccagaagttctaaaagaaagg
cttcctggaatatctgagaccgctgcaatcttcgctggtgttgatgttaccaaagagcca
atcccagtcttgcctactgtgcactataacatgggtggtatcccaacaaattaccacggc
gaggtagtgaccatcaaaggagatgatccagatgcagtggttccagggcttatggctgct
ggggaggcagcttgtgcatctgttcacggtgccaacaggcttggtgcaaattctctcctc
gacattgttgtgtttggccgtgcttgtgcgaatagggtagcagagataagcaaaccaggg
gagaaacagaggcctctggaggagaatgcaggcaagaagacgatagaatggctgaacaag
ttaagacactcaagcgggtcgcttcctacatcaagtatcagattgaacatgcagaggatt
atgcagaacaatgcagctgtcttccgcacgcaagaaacattggaagaaggttgtcagttg
atcgacaaggcatgggaaagtttcgaggatgtccaggttaaagatcggagtttaatatgg
aactctgatctgatagagacaatagaactggagaacctattgataaacgcttcaataaca
atgcattcagcggaagcacgaaaggaaagcagaggagcacatgctcgggaagatttcacg
aaaagagaggatggagaatggatgaagcatacattggggtattgggaagacgagaaagtg
aggttggagtataggcctgttcacatggacactctcgacgatgagattgacactttccct
cccaaagctcgcgtctactga

DBGET integrated database retrieval system