KEGG   Brassica rapa (field mustard): 103830523Help
Entry
103830523         CDS       T03449                                 

Definition
(RefSeq) glutathione S-transferase U19
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00480  Glutathione metabolism
brp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103830523
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:brp02000]
    103830523
Enzymes [BR:brp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103830523
Transporters [BR:brp02000]
 Other Transporters
  Pores ion channels [TC:1]
   103830523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_C GST_N_2 GST_C_3 GST_C_5 GST_N_4 GST_C_6
Motif
Other DBs
NCBI-GeneID: 103830523
NCBI-ProteinID: XP_009104572
UniProt: A0A397YQD1
LinkDB All DBs
Position
A7
AA seq 219 aa AA seqDB search
MAKEVILLDFWPSMYGMRTRIALREKGVDFEYRDENLREKSPLLLQMNPVHKKIPVLIHN
GKPVCESAIQVQYIDEVWPHKNPILPSDPYQRAQARFWVDFIDKKMYEAQRKVYATKGEE
QETGKKEFIEILKTLESELGDKPYFGGDDFGYVDIGLIGFYTWFPGYEKFGNFSIEAECP
KLIAWAKRCMQRESVAKSLPDPEKVVEFMAMLRKKFGVE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggaagtgatccttcttgatttctggcctagcatgtacggcatgaggacaaga
atcgcgctgagggagaaaggtgtcgacttcgagtacagggacgagaatctgagggagaag
agccctctgctcctccagatgaacccggttcacaagaagattccggttctcatccacaac
ggtaaaccggtctgcgaatcagccatccaggttcagtacatcgacgaggtgtggcctcac
aagaaccctatcctcccttctgatccttaccagagagctcaggctaggttctgggttgat
ttcatcgacaagaagatgtacgaggcacagaggaaggtgtatgcgaccaagggtgaggaa
caagagacaggcaagaaggagttcattgagatcctcaagactcttgagtccgagcttgga
gacaagccttactttggtggggatgactttgggtatgtggacattggtcttattggattc
tacacatggttccctgggtatgagaagtttggtaacttcagcatcgaagcagagtgtccg
aaactgattgcatgggctaagaggtgtatgcagagggagagtgtggccaagtccttacct
gatcctgagaaggttgttgagttcatggctatgctcaggaagaaatttggggttgagtag

DBGET integrated database retrieval system