KEGG   Brassica rapa (field mustard): 103831125Help
Entry
103831125         CDS       T03449                                 

Gene name
SP6
Definition
(RefSeq) DNA ligase 6
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp03030  DNA replication
brp03410  Base excision repair
brp03420  Nucleotide excision repair
brp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:brp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    103831125 (SP6)
   03410 Base excision repair
    103831125 (SP6)
   03420 Nucleotide excision repair
    103831125 (SP6)
   03430 Mismatch repair
    103831125 (SP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:brp03032]
    103831125 (SP6)
   03400 DNA repair and recombination proteins [BR:brp03400]
    103831125 (SP6)
Enzymes [BR:brp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103831125 (SP6)
    6.5.1.6  DNA ligase (ATP or NAD+)
     103831125 (SP6)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103831125 (SP6)
DNA replication proteins [BR:brp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103831125 (SP6)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103831125 (SP6)
DNA repair and recombination proteins [BR:brp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103831125 (SP6)
   NER (nucleotide excision repair)
    Other NER factors
     103831125 (SP6)
   MMR (mismatch excision repair)
    Other MMR factors
     103831125 (SP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 103831125
NCBI-ProteinID: XP_009105223
LinkDB All DBs
Position
A7
AA seq 1374 aa AA seqDB search
MASDSAGATIAGDFPNDDNAEALNLNSTELYSSAVPSSVPTPSLKPPFSPLSIPQSNRIP
KTNFTVDFFRSSSSSVAFFLSHFHSDHYSGLSSSWSRGIIFCSHITARLLKQILQVPSQL
VFPLPTNQKVIIDGSEVVLIDANHCPGAVQFLFKTNDGSERYIHTGDFRFCDSMRSDPFL
SSFVGCDVVFLDTTYCNPKFVFPTQQESVDYVISVIDKIDEESKQMKKKVLFLVATYVVG
KEKILIEISKRCNRKIFVEERKMSILNVLGCGEGGMFTEDKEESDVHVVGWNVLGETWPY
FRPNFVKMNEVMVERGYDKVVGFVPTGWTYEVKRNKFAVKVKDSMEIHLVPYSEHSNYDE
LREYIKLLRPKRVIPTVGVDVEKMDSREVYKMQKHFSGLVDEMANKKEFLLGFYRQSDKK
SEKDGVDVRENDAPGSDSLVTERLLIELRDSLPAWVSEEQMLDLIKKHAGNPVDIVSNFY
ECEAEFYKQSCIATSSLENQAVLIDDDGIDLQPIPAKGISSDCQESLKGFALPSKLGLTK
GIVSPGKRSKSIGNKSNKKAKKDPKSKPVGPGQSTITKFFDKVLDSGSSSVGVGSETEEC
NTDEKMVHNDAKETYKEVTDQFIDIVHGSESLREYAASIIDEAKGDINRALDIYYSKPSD
VPGEHAGEGGGLSSESNQLTQCPEACSSQENIKTSEKSGHTLNLSEQTSAKEMVDNDYVS
LPPEKYKPKEHGCAACWRDGQPTPYIHLVRTFASVEGEKGKIKAMSMLCNMFRSVLALSP
EDVLPSVYLCTNKIAADHENIELNIGGSLISAALEEACGISRSTMREMYNRLGDLGDVAQ
LCRQTQKLLVPPPPLLVRDVFSTLRKISVQSGTGSTRQKKNLIVKLMRSCREKEIKFLVR
TLARNLRIGAMLRIVLPALGRAIVMNSFWNCHNKEPSENWFKEKLEGVSAAVVEAYNILP
SLDVVVPSLMEKDIEFSTSTLTMIPGIPIKPMLAKIANGVQDFIKLFQDKAFTCEYKYDG
QRAQIHLLLDGTVRIFSRNGDETTSKFPDLVDVIKQFACPAAETFMLDAEVVATDRKNGN
QLMSFQELSTRERGSKDALVITKSIKVEVCIFVFDIMFFNGEQLLTLPLRERRKCLKEVF
PETRPGFLEYAKEITVGTEEASMNNQDTLCRINAFLGEAFQSSCEGIMVKSLDVDAGYCP
TKRSDSWLKVKRDYVDGLGDTLDLVPIGAWHGNGRKAGWYSPFLMACYNPETEEFQSVCR
VMSGFSDAFYVEMKEFYSEDKILAKKPPYYRTGETPDMWFPAEVVWEIKGADLTVSPVHS
AALGLVHPSRGISVRFPRFICKRADRDPEECSTAADIAEMFHAQTRKMNIKSQH
NT seq 4125 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgactccgccggagcaacaatcgccggcgacttcccaaacgacgataacgcg
gaagccctaaacctcaattctacagaactctactcatcagcagttccctcctccgttcct
acaccctccctgaaaccaccgttctctcctctctcaatccctcaatcaaaccgaatcccc
aaaacaaactttaccgtcgacttcttccgctcctcctcctcctccgtcgctttcttcctc
tcacacttccactccgaccactactccggcctctcctcttcctggtcccgaggaatcatc
ttctgctctcacataaccgcacgcctcctcaaacaaatcctccaagtcccgtcgcagctc
gtcttccctctacctacgaatcaaaaagttatcatcgatggctccgaagtcgttctcatc
gacgcgaatcactgcccaggagctgtacagttcctcttcaaaaccaacgatggctccgaa
aggtacattcacaccggagacttcagattctgcgattcgatgagatcagatcccttcctt
agtagcttcgttggctgcgacgtcgtttttctcgacactacttattgcaatccgaagttc
gttttccccacgcagcaagagtctgttgattatgtgattagcgtgatagataagatcgat
gaagagtctaagcaaatgaaaaaaaaggttttgtttcttgttgctacttacgttgttggt
aaagagaagattttaattgagattagtaagagatgcaataggaagatctttgtggaggag
aggaagatgtcgattttgaatgtattggggtgtggagagggtggaatgttcacagaggat
aaggaagagagcgatgttcatgttgtgggatggaatgtgttgggagagacttggccgtat
tttcgtccgaatttcgtgaagatgaatgaggttatggttgagagagggtatgataaggtt
gtaggttttgtgcccacggggtggacttatgaggtgaagaggaataagtttgcggtgaag
gttaaggattctatggagattcatcttgtgccgtatagcgagcattcgaattacgatgag
cttagggagtacataaagttgttgaggcctaaacgagttattcctacagttggtgttgat
gtggagaagatggatagcagggaggtttataaaatgcagaagcatttttctggactggtt
gatgagatggcgaacaagaaagagtttttattggggttctatcgtcagtctgacaagaag
agtgagaaagatggcgtagatgttagggaaaatgatgctccaggaagtgattctttggtg
actgaaagattgctgatagaactacgtgattctttgcctgcttgggtaagtgaagagcag
atgttagatctgattaagaaacatgctggtaaccctgtagatatagtaagtaacttctat
gaatgcgaagcagagttttacaagcaatcctgtattgccacgtcttccttggagaatcag
gctgttttgattgatgacgatggaatcgacttgcagccaattcctgctaagggcatttcg
tcagattgtcaagaaagtctaaaaggttttgccttaccaagcaaacttggtttaacaaag
ggtattgtttctccggggaaaagaagcaaaagcattggcaataagtcaaacaagaaggcc
aaaaaagatccaaagtcgaaaccagttggtccagggcagtcaaccataactaagtttttc
gataaggtgttggatagtggatctagttctgttggtgttggttcagagactgaagaatgc
aatacagatgaaaagatggtccacaatgatgctaaagaaacatacaaagaagtaacagat
caatttattgacattgttcacggttctgagtctttaagagagtatgctgcttccatcatt
gatgaggctaaaggagatataaatagggcactggacatctattacagtaaacccagtgat
gtacctggtgagcatgcaggtgagggaggaggactctctagcgaatcaaatcagttaacg
caatgtccagaagcgtgctcctcccaggagaacattaagacgtcagaaaaatcagggcat
acattgaacttaagtgagcagacatcagcaaaagaaatggtggacaatgattatgtatct
ctacctcctgaaaaatataagcctaaagagcatggttgtgcagcttgttggagggatgga
cagcctactccgtatatccaccttgtccggacatttgcttcggtcgaaggtgaaaagggc
aagatcaaagctatgtctatgctttgcaacatgtttagaagcgtgttggctctctctcca
gaagatgtgctgccctctgtttatctttgcacaaataagattgccgctgaccatgagaat
attgagctcaacattggtggaagtctgatctctgctgcattggaagaagcatgtggaata
agtcggtctactatgagggagatgtataatagattgggagatcttggggacgttgctcag
ctgtgccgacaaacgcaaaagctactagttcctccacctccacttctagttagagatgtg
ttttcaactctacgaaagataagtgtgcagtcaggtactggaagtactaggcaaaagaaa
aacctcatcgtgaagctaatgcgctcttgtagagagaaagagatcaaatttctagttaga
acattggcccgtaatttaaggattggcgctatgttgagaattgttctacctgcactaggg
cgagcaattgttatgaattctttctggaattgccataacaaagaaccatcagaaaattgg
ttcaaagagaaacttgagggtgtttctgctgcagtagttgaggcctacaatatacttcct
tctctggacgtggttgttccttctctcatggaaaaagacattgagttttcaacatcaact
ctgacaatgatcccagggataccaataaaacccatgcttgcaaaaattgctaacggggtt
caagattttatcaagctcttccaagacaaggcttttacatgtgaatacaagtatgatggc
cagcgcgcccagatccatttgttacttgatggtacagtgcggattttctctcgaaatggg
gatgaaactacttccaaatttcctgatctggttgatgttataaaacagtttgcttgccct
gctgctgagacgttcatgttggacgcagaggttgttgcaactgatagaaagaatggtaac
caactcatgtcattccaagagttatcaacaagagagagagggagcaaagatgctttggta
attacaaaaagtattaaggttgaagtctgcatctttgtgtttgatattatgttcttcaac
ggtgaacagctgttgactcttcccctccgtgagagacgaaaatgtctaaaggaggtcttc
cctgagactaggccaggttttctcgaatatgctaaggaaatcactgtgggaacagaagaa
gcttctatgaataaccaagacactttgtgtagaataaatgcgtttctaggagaagcattt
cagtcatcttgtgagggaatcatggttaagtctttagatgttgatgccggatactgcccc
acaaagcgttctgattcatggcttaaggtgaagcgagattatgttgatggattaggtgac
acattggatttagttcctataggtgcttggcatggcaacgggagaaaagccggatggtat
agtccattcctcatggcctgctacaaccctgagactgaggaattccagagtgtctgccgt
gtcatgtctgggttttctgatgccttttacgtcgagatgaaagaattctactccgaggat
aagatcctcgcgaaaaagccgccatactacagaacaggggagacaccagacatgtggttt
cccgcagaggttgtctgggaaatcaaaggtgcggatctaaccgtctcacctgtacacagt
gcggctttaggtctggtccatccatcacgaggcatctccgttaggtttccaagattcatc
tgtaaaagggcggatagggatccggaggaatgcagcacggcggcagatatagcagagatg
tttcatgctcaaaccagaaaaatgaacatcaagtctcaacactaa

DBGET integrated database retrieval system