KEGG   Brassica rapa (field mustard): 103832317Help
Entry
103832317         CDS       T03449                                 

Definition
(RefSeq) glutathione S-transferase U21
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103832317
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:brp02000]
    103832317
Enzymes [BR:brp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103832317
Transporters [BR:brp02000]
 Other Transporters
  Pores ion channels [TC:1]
   103832317
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C_2 GST_N_3 GST_C GST_N_2 GST_C_6 GST_C_5
Motif
Other DBs
NCBI-GeneID: 103832317
NCBI-ProteinID: XP_009106545
LinkDB All DBs
Position
A7
AA seq 220 aa AA seqDB search
MAEEVILLNFWPSMFGMRTMIALKEKEVKYEHREEDLINNKSALLLEMNPIYKKIPVLIH
NGKPICESVIQVQYIDEIWSDKNPLLPKDPYQRAQALFWADFIDKKLYVCGRKTWATKGE
EQEEAKKEFIGILKTLQSELGDKPYFGGDRFGFLDIVLIGFYSWFPAYQKFGNFSIEPEC
SKLMDWGKRCMERESVATSLPDPERVGGFILQLKKLYGIE
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaggtgatccttctgaacttctggccgagcatgtttgggatgaggactatg
attgcgttgaaggagaaagaagtgaagtatgagcacagagaagaagatctgatcaacaac
aagagtgccttgcttcttgagatgaatcctatttacaagaagataccggttctcatccac
aatggtaaaccaatctgtgaatctgtcatacaggttcagtacatagacgagatctggtca
gacaagaacccgttacttcctaaagatccttaccagagagctcaagccttgttttgggct
gacttcattgacaagaagttgtatgtttgtgggagaaagacttgggcaacaaagggtgag
gagcaagaagaagccaaaaaggagttcattggaatactaaagactcttcaatctgagctt
ggagataaaccttactttggtggcgatagattcgggtttttagacattgtcctgattgga
ttctacagctggtttccagcgtaccagaagtttggtaacttcagcatcgaaccagagtgt
tctaaactgatggattggggcaaaaggtgtatggagagggagagtgtagctacatccttg
cctgatcctgagagagttggtggattcattttacagcttaagaagctatatgggatcgag
taa

DBGET integrated database retrieval system