KEGG   Brassica rapa (field mustard): 103834740Help
Entry
103834740         CDS       T03449                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein AIM1-like
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00071  Fatty acid degradation
brp00592  alpha-Linolenic acid metabolism
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
brp01212  Fatty acid metabolism
Module
brp_M00087  beta-Oxidation
brp_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103834740
   00592 alpha-Linolenic acid metabolism
    103834740
Enzymes [BR:brp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     103834740
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     103834740
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     103834740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 103834740
NCBI-ProteinID: XP_009109066
LinkDB All DBs
Position
A8
AA seq 721 aa AA seqDB search
MAKKIGVTMEVGNDGVAVITISNPPVNSLASQIISGLKEKFQDANQRSDVKAIVLTGNGG
RFSGGFDINVFQQVHKTGDISLMPEVSVDLVCNLMEDSRKPLVAAVEGLALGGGLELAMA
CHARVAAPKAQLGLPELTLGIIPGFGGTQRLPRLIGLEKGTDMILLSKSISSEEGQKLGL
IDALVPPGDLLTTSRKWALDIACGRKPFLRSLHRTDKIGSLSEARAILMKARQLAKRIAP
NMPQHHACIEVIEDGIIHGGYSGVLKEAEVFKQLVLSDTAKALVHVFFAQRATSKVPKVT
DVGLKPRPMKKVAVIGGGLMGSGIATALLLSNIRVVLKEINSEYLLKGIKSVEANLKGLV
SRGKLTQDKAGKAFSLLKGVLDYTEFKDVDMVIEAVIENIQLKQKIFKEIEEVCPPNCIL
ASNTSTIDLNVIGEKTNSKDRIVGAHFFSPAHLMTLLEIVRTENTSAQVILDLMALGKAI
KKVPVVVGNCIGFAVNRTFFPYSQAAHMLVNLGVDLFRVDSVITSFGLPLGPFQLGDLAG
HGIGIAVKDIYAKAYGDRMFVSPLTELLLKSGRNGKINGRGYYIYEKGSKPKPDSSVLSV
VEESRKLTNIMPGGKPITVTDKEIVEMILFPVVNEACRVLDEGVVIRASDLDVASVLGMS
FPSYRGGLLFWADTVGPKYIYERLKRLSETYGGFFKPSRYLEERATKGMLLSEPKSSRSR
L
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaagattggagtgacgatggaagttgggaacgatggtgttgctgtgatcacc
atctcgaaccctcctgttaactctttagcaagtcaaattatatctggtttgaaggagaag
tttcaagacgctaatcagaggagtgatgttaaggccatcgtgttgaccgggaacggtgga
agattttcgggtggtttcgacatcaatgtcttccagcaagttcacaagactggggatata
tcgcttatgcctgaagtatccgttgaccttgtgtgcaacctgatggaagactctaggaag
ccgcttgttgctgcagttgaaggactagctcttggtggtggtttagaactggcaatggcg
tgtcatgctcgagtggctgctccaaaagctcaactaggcttaccagagctgacacttggg
attattcctggttttggaggaacccaacgtcttcctagattgataggccttgagaaagga
actgatatgatactgctttcaaagtcgatatcctcagaggaggggcagaaactgggtctt
attgatgcgttagtgccgcctggagatttgttgaccacgtccaggaagtgggctctagac
attgcatgtggacgtaaaccttttttgcggtcactgcacaggacggacaaaattggttct
ttatctgaagctcgtgctatattgatgaaagcaagacaactagccaagaggatagcccca
aatatgcctcagcaccatgcttgcattgaggtgattgaagatggaatcatccatggagga
tatagtggggttcttaaggaagcagaagttttcaagcaattagtactctcagacactgca
aaggctcttgttcatgttttctttgcacagcgtgcaacatcaaaggtgcctaaggtaact
gacgttggattgaaacctagaccgatgaaaaaagttgcagtgattggtggaggtctgatg
ggttctggaatcgctactgctcttcttctaagcaatataagagtcgtgctcaaagaaatc
aattcagagtaccttctcaagggaataaaatcagttgaagcaaatctcaaaggcttggtt
tctaggggaaaactgacacaagataaagcaggcaaggccttctctttgctcaagggagta
ctcgattacacagagttcaaagacgtggacatggtcatagaggcagtgattgaaaacatt
cagttgaaacaaaagatattcaaagaaatcgaggaggtctgtccaccaaattgcattttg
gctagcaacacatctactatcgacctcaatgtaatcggagaaaaaactaactcgaaagat
cgcattgttggcgcacatttcttcagcccggcacatctgatgacccttctggagattgtt
cgcacagagaacacttctgctcaggtgattcttgatctcatggcacttggaaaagccata
aagaaagtccccgtggtggttggaaactgcataggctttgcagtgaatagaacattcttt
ccgtattcacaagctgcacacatgttggtcaatctaggcgttgatttgttcagagtagac
agcgttatcacctctttcggcttgccattaggccctttccagctaggtgatttggctgga
cacgggattggcatagcagttaaagacatatatgccaaggcctatggtgaccgaatgttc
gtctctccattgactgagcttctgcttaaaagcgggagaaatgggaagatcaacgggaga
ggatactacatttacgagaagggaagcaaaccaaaacctgattcatcagtgctttctgtt
gttgaggaatcaaggaaacttaccaatatcatgcctggtgggaagcctataacagtaact
gataaagagatcgttgagatgatcttgttccctgtggttaacgaggcctgccgtgtccta
gatgaaggagttgtgatccgagcctcagacttggacgttgcttctgtcctcggaatgagt
tttccttcttaccgcgggggacttcttttctgggcagacacggttggaccgaagtacata
tatgaaaggctgaagagattgtcggagacttatggtggctttttcaaaccatcaaggtat
ctggaggaaagggcaacgaaaggaatgcttttgagtgaacctaaatcgtcgaggtctcga
ctgtga

DBGET integrated database retrieval system