KEGG   Brassica rapa (field mustard): 103835052Help
Entry
103835052         CDS       T03449                                 

Definition
(RefSeq) probable hexokinase-like 2 protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00010  Glycolysis / Gluconeogenesis
brp00051  Fructose and mannose metabolism
brp00052  Galactose metabolism
brp00500  Starch and sucrose metabolism
brp00520  Amino sugar and nucleotide sugar metabolism
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
brp01200  Carbon metabolism
Module
brp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
brp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103835052
   00051 Fructose and mannose metabolism
    103835052
   00052 Galactose metabolism
    103835052
   00500 Starch and sucrose metabolism
    103835052
   00520 Amino sugar and nucleotide sugar metabolism
    103835052
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103835052
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:brp04131]
    103835052
Enzymes [BR:brp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103835052
Membrane trafficking [BR:brp04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103835052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF4179
Motif
Other DBs
NCBI-GeneID: 103835052
NCBI-ProteinID: XP_009109397
LinkDB All DBs
Position
A8
AA seq 493 aa AA seqDB search
MARKEVVVAVTAATVSAVAAAVIIGQWVRRKEQRRKQTQMILRKFARECATPVLKLWAVA
DALVADMAAFLSATTAAGSCGSLNMLVSFAGALPSGDEKGLHYGVNLRGKELLLLRGALG
GNEEPISDVHKQEISIPADVSNGSFKELCDYISLELVKFIGMNPGEETDEVKNLGFTLTR
YVEEIGPSSISAIQRKGLANDDDDTVLKEFVNDMNESLESHGLKIRMNMALVDDTIGVLA
GGRYYHKDTVAAVTLGMGTNAAYIEQAQEVLRWKPTIPNEPQEIVISTEWGDFRSCHLPV
TEYDAALDAESLNPRSCVFEKMVAGGYLGEIVRRVLLKMSQETALFGDILPPKLTTPYTL
SSPDMAAMHQDISEDRDIVNKKLKDVFGVMYSTLAAREVVIEVCDLVAERAARVAGAGIV
GMVKKLGRLEKKMSIVIVEGGLYDHYRVFRNYLHSSVWEMLGDELSDHVVIEHSHGGSGA
GALFFAACGNVKT
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggccaggaaagaggtggtggtggcggtcactgctgcgacggtttctgcggttgcagcg
gctgtgataattggtcaatgggtgcggaggaaggagcagcggcggaaacaaacacagatg
attttaagaaaattcgctagagaatgcgccacgccggttttgaagctatgggcggtggcg
gacgccttggtagccgacatggccgcctttctctctgccaccacagccgccgggagttgc
ggctccctcaacatgctcgtttcattcgccggtgctctcccttcaggggatgagaaggga
ctacattatggagttaacttgcgaggcaaggaacttctactgttacgtggagctttagga
ggtaacgaagaacctatttccgatgtacataaacaggagatttcaatccctgcggatgtt
tcaaacggttcttttaaggagctgtgcgattacatatccttggagctagttaaattcatt
gggatgaatcctggggaagaaacagatgaagtcaagaatctagggttcacgttgacacgc
tatgtcgaggagattgggcctagttcaatctcggcgatacagaggaagggcttagcaaat
gatgacgatgacacggttttgaaggagtttgtgaatgatatgaatgaatcactggagagt
cacggactgaagattcggatgaacatggcgctggtggatgacacaattggagtgttggct
ggaggaaggtactatcataaggacactgtggctgcagtcactttaggtatgggaacgaac
gctgcttacatcgaacaagctcaagaggtcctgagatggaaacccacgataccaaacgag
ccacaagagattgttattagcacggagtggggagatttcagatcatgtcatcttcctgta
actgaatatgatgctgctcttgacgcagaaagcttgaatcctagaagctgcgtatttgag
aagatggtggctggaggatacttaggggagatagtgagaagagtgttgctaaaaatgtca
caagaaactgctttatttggagatatactacctccaaaactgacaaccccttacacttta
agttcgccagatatggccgcgatgcatcaagatatatcagaagatcgagatattgtaaac
aaaaagctcaaggacgttttcggggtcatgtattcaactcttgcggctagagaagtggtg
attgaagtgtgcgatttagtggccgaaagagctgcgcgtgtggcaggagcaggaatagtt
gggatggtaaagaagctgggaaggttagagaaaaagatgagcattgtgatagttgaagga
gggttgtatgatcattacagggtctttagaaactatcttcatagcagtgtttgggaaatg
ctcggcgatgagttatcggaccatgtcgtcattgagcattctcacggtggatctggtgcc
ggagcccttttctttgctgcttgcggcaacgttaaaacctaa

DBGET integrated database retrieval system