KEGG   Brassica rapa (field mustard): 103837712Help
Entry
103837712         CDS       T03449                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00020  Citrate cycle (TCA cycle)
brp00190  Oxidative phosphorylation
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
brp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103837712
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103837712
Enzymes [BR:brp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103837712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 103837712
NCBI-ProteinID: XP_009112332
LinkDB All DBs
Position
A9
AA seq 628 aa AA seqDB search
MWRCVSRSLRAPSSRTSLSGSRFSRFFSSSSSQTGDYTIVDHTYDAVVVGAGGAGLRAAI
GLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQDA
IQYMCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGH
ALLHTLYGQAMKHNTQFFVEYFALDLLMASDGTCQGVIALNMEDGTLHRFRSAQTILATG
GYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGI
LRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPHKDHIYLHLNHLPPEVLK
ERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVVPGLM
AAGEAAFASVHGANRLGANSLLDIVVFGRACANRVAEISKPGEKQRPLEENAGKKTIEWL
NKLRHSSGALPTSSIRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFEDVQVKDRSL
IWNSDLIETIELENLLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDE
KVRLEYRPVHMDTLDDEIETFPPKARVY
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtctctcgtagcctccgagctccttcatcaaggacctcactctctgga
tctcgcttttctagattcttctcctcctcctcctctcagacgggtgattacacgatagtg
gatcacacctatgacgcggtcgttgttggagctggtggtgctggcctcagggcggccatt
ggattatccgagcatggctttaacaccgcttgcattaccaagcttttccccacccgctcc
cataccgtcgctgctcagggtggtataaacgctgcactgggaaacatgtctgaagatgat
tggagatggcacatgtatgatactgttaaaggcagtgactggcttggtgatcaagatgct
atccagtacatgtgtagagaggcaccaaaagcagtgattgaacttgagaactacggcctt
cctttttcccgtactgaagagggtaaaatctaccagcgtgcctttggtggtcagagtctc
gactttggcaaaggtggtcaggcctatcgttgtgcttgcgctgctgatcggactggacat
gctctcttgcataccctatatggacaagctatgaagcataacacacagttctttgttgaa
tacttcgctctggatttgctcatggctagtgatggtacttgccagggtgtaattgcacta
aacatggaagacggaacactgcatcgtttccgctctgcacaaacaattttggccactggg
ggttatggcagagcatacttctcagcaacctcagcacatacttgcacaggagatggcaat
gccatggttgcacgtgccggtcttccactccaggacttggagtttgttcagttccaccca
actggtatatatggagccggatgtctcatcactgaaggatctcgaggtgaaggtgggatc
cttagaaatagtgaaggtgaacgttttatggaacgatatgctccaactgccaaggatctt
gcatcaagagatgttgtctccagatctatgactatggaaatcagggaaggtcgtggtgta
gggccgcataaggatcatatctatctccatttgaatcatcttccaccagaagttctgaaa
gaaaggcttcctggaatctctgagacagctgcaatctttgctggtgttgacgttaccaaa
gagccaattccagttttgcccactgtccactacaacatgggtggtattccaacaaattac
cacggcgaggtagtgaccataaaaggagatgatccagatgcagtggttcctgggcttatg
gctgctggggaggcagcttttgcatctgttcacggggccaacaggcttggtgcaaattct
ctcctcgatattgttgtgttcggccgtgcttgtgcaaatagggttgcagagataagcaaa
ccaggtgagaaacagagacctctagaggagaatgcaggtaagaagacgatcgaatggctg
aacaagttaagacactcaagcggggcgcttcctacatcaagcatcagattgaacatgcag
aggattatgcagaacaatgcagctgtcttccgcacccaagaaacactggaagaaggttgt
cagttgatcgacaaggcatgggaaagtttcgaggatgtccaggttaaagatcggagtttg
atatggaactctgatctgatagagacaatagagttggagaaccttctgataaacgcgtcc
ataacaatgcattcagcggaagcacgaaaggaaagcagaggagcacatgctcgggaggat
ttcacgaaaagggaggatggagaatggatgaagcatacattggggtactgggaagatgag
aaagtgaggttggagtataggcctgttcacatggacactctcgacgatgagattgagact
ttccctcccaaagctcgcgtctattga

DBGET integrated database retrieval system