KEGG   Brassica rapa (field mustard): 103839459Help
Entry
103839459         CDS       T03449                                 

Definition
(RefSeq) glutamate decarboxylase 4-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00250  Alanine, aspartate and glutamate metabolism
brp00410  beta-Alanine metabolism
brp00430  Taurine and hypotaurine metabolism
brp00650  Butanoate metabolism
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
Module
brp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    103839459
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103839459
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103839459
   00430 Taurine and hypotaurine metabolism
    103839459
Enzymes [BR:brp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103839459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 103839459
NCBI-ProteinID: XP_009114216
LinkDB All DBs
Position
A9
AA seq 493 aa AA seqDB search
MVLSKTASETDASIHSTFASRYVRISLPRFEMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMESINKNYVDMDEYPVTTELQNRCVNMIARLFNAPLDDGEAAVG
VGTVGSSEAIMLAGLAFKRQWQNKRKAQGLPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYVMDPEKAVEMVDENTICVAAILGSTLTGEFEDVKLLNDLLVEKNKLTGWNTG
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRTKSDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMDNCRENMMVLREGLEK
TGRFNIVSKENGVPLVAFSLKDNSRHDEFEVAETLRRFGWIVPAYTMPADAEHVTVLRVV
IREDFSRTLAERLVADFEKVLRELDTLPAKVHAKMANGKAKGVKKTEEETTREVTAYWKK
FVETKKTNKNKIC
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggttttgtctaagacagcttctgaaactgatgcttcaatccattcaacttttgcttct
cgttacgtccgcatctctctcccacgattcgagatgcctgagaactctatccctaaggaa
gcagcgtatcagatcatcaacgatgagctaatgctcgacggtaaccctaggctaaaccta
gcctctttcgtaaccacgtggatggagccagagtgtgacaagctcatgatggaatccatc
aacaagaactacgtcgacatggatgagtaccctgtcaccaccgagcttcagaaccgatgc
gtcaacatgattgcgcgtctctttaacgctccgctcgatgacggcgaggcagcggttggt
gtcggcaccgtgggatcgtcggaggcgattatgttagccgggttggcttttaagagacag
tggcagaacaagcgtaaggcccaagggcttccttatgacaagcccaatatcgtaaccgga
gctaatgttcaggtttgctgggagaaattcgcaaggtatttcgaagtggaacttaaggaa
gtgaagctaagagaaggatactacgtgatggaccctgaaaaggcagtcgaaatggtagac
gagaacaccatttgtgtagcagccattctaggttcgacgctaaccggagagttcgaggac
gttaagctcctcaacgacctcctagtcgagaaaaacaagctaaccggatggaatacgggg
attcacgtggatgcagcgagtggtgggtttattgcaccgttcttgtatccggagctggag
tgggactttcggttaccattggttaagagcataaatgtgagtggtcacaaatacggtttg
gtttatgccggaatcggttgggttgtgtggagaaccaaatctgatctgccggaagaactt
atcttccacatcaattatcttggcgctgatcaacccaccttcactctcaacttctccaaa
ggttcgagtcaagtgattgctcagtactaccagctgattcgtcttggattcgagggatat
cgtaacgtgatggataattgccgcgaaaacatgatggtcctaagagaaggattagagaaa
actggacgtttcaacattgtctccaaagaaaacggtgttcctttagtggcgttttctcta
aaagacaatagccgccacgacgagttcgaagtggccgaaactctccgccgcttcgggtgg
atcgttccggcctacacgatgcccgcggatgcagaacacgtcaccgtcctccgagtggtg
attcgagaagatttctctcgaaccttagccgagagattggtcgcagactttgagaaggtt
cttcgcgagctcgatacacttccggcgaaggttcacgccaagatggctaatggaaaagct
aaaggtgttaagaagacggaggaggagacgacgagggaagttacggcatattggaagaag
tttgtggagacaaagaagactaacaagaacaagatttgctaa

DBGET integrated database retrieval system