KEGG   Brassica rapa (field mustard): 103840735Help
Entry
103840735         CDS       T03449                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00010  Glycolysis / Gluconeogenesis
brp00053  Ascorbate and aldarate metabolism
brp00071  Fatty acid degradation
brp00280  Valine, leucine and isoleucine degradation
brp00310  Lysine degradation
brp00330  Arginine and proline metabolism
brp00340  Histidine metabolism
brp00380  Tryptophan metabolism
brp00410  beta-Alanine metabolism
brp00561  Glycerolipid metabolism
brp00620  Pyruvate metabolism
brp00903  Limonene and pinene degradation
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103840735
   00053 Ascorbate and aldarate metabolism
    103840735
   00620 Pyruvate metabolism
    103840735
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103840735
   00561 Glycerolipid metabolism
    103840735
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103840735
   00310 Lysine degradation
    103840735
   00330 Arginine and proline metabolism
    103840735
   00340 Histidine metabolism
    103840735
   00380 Tryptophan metabolism
    103840735
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103840735
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    103840735
Enzymes [BR:brp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103840735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487 BMC DtxR
Motif
Other DBs
NCBI-GeneID: 103840735
NCBI-ProteinID: XP_009115500
UniProt: A0A397XYW3
LinkDB All DBs
Position
A9
AA seq 536 aa AA seqDB search
MASRRVSSMLSRSFMSSPSLFALRGKHHNMNRGVYGYSNVAAGEDTITPPVKVEHTQLLI
GGKFVDAASGKTFPTLDPRTGEVIAQVAEGDVEDVNRAVSAARKAFDEGPWPRMTAYERS
KILLRFADLVDKHNDEIAAIETWDNGKPFEQSSKIEVPMLARVFRYYAGWADKIHGMTVP
GDGSHHVQTLHEPIGVAGQIIPWNFPLLMLSWKLGPALACGNTVVLKTAEQTPLSALLVG
RLLHEAGLPEGVVNIVSGFGPTAGAAIASHMDIDKVAFTGSTDVGKIILQLASKSNLKAV
TLELGGKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKAR
AIKRAVGDPFKSGIEQGPQVDSEQFKKILKFIKHGVESGATLQAGGDRFGSKGYYIQPTV
FSDVKDDMLIATDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTQNLDTANRLMRA
LRVGSVWINCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTAIKNPAWL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaagaagagtatcttcaatgctctctcgctccttcatgtcctcgccttctctg
ttcgctcttagaggcaaacaccacaacatgaacagaggagtttacggatacagcaacgtt
gctgcaggcgaagacacgatcactccgcctgtgaaagtagagcacacacagctcttaatc
ggcggaaagttcgttgatgcggcctcaggaaagactttccccactttggatccaagaact
ggagaagtgatcgctcaggtggctgaaggtgatgtggaagacgtgaaccgtgcggtttcg
gctgcacgcaaggcctttgatgaaggaccatggcctagaatgacagcttatgagagatca
aagatacttcttcgtttcgctgacttggtcgacaaacacaacgacgagattgctgctatc
gagacttgggacaatgggaagccttttgaacagtcttccaagattgaagttcctatgctt
gctagggtgttccgttactatgctggttgggcagacaagatccatggaatgacggttcca
ggagacggttcacaccatgtgcagacactccatgagcctattggagtcgctggacagatc
atcccatggaacttccctcttctcatgctttcttggaaacttggaccagctttggcttgc
ggtaacaccgttgtcctcaagacggctgagcaaactcctctatctgctcttcttgttgga
cgactacttcacgaggctggacttccggaaggagttgtgaatatagtgtctggatttggt
cctacagctggtgcagccatagctagtcacatggacattgacaaggttgctttcaccggt
tctactgatgtgggaaagattattcttcagttggcttcaaaaagcaaccttaaggcagtg
acccttgagcttggaggcaagtcaccgttcattgtatgtgaagatgctgatgtggatcag
gccgttgagctcgctcatttcgctttgttcttcaaccagggacaatgctgctgtgctggc
tcgcgtacatttgtacatgaacgtgtgtatgatgagtttgtagagaaagctaaagctcgt
gcaatcaaacgcgctgttggcgatcccttcaagtctggcattgagcaaggtcctcaggtg
gactcagagcaatttaagaaaatcctgaagttcattaaacatggagttgagagtggagcc
accttacaagctggaggcgaccggtttggttccaagggatactacattcaacccactgtc
ttctcagacgtcaaagacgacatgctcatagcaacagacgagattttcggaccggttcaa
accatacttaaattcaagaatctagatgaggtgattgcaagggctaacaactcaaggtac
ggtttagctgcgggagtgttcacacagaatctggacactgcgaacaggctgatgcgagcg
ctgagggttggtagcgtttggataaactgtttcgatgtgtttgatgccacaattccattc
ggagggtacaagatgagtgggattggaagagagaaaggtatctacagtctcaacaattac
ttgcaagtcaaggctgttgttactgccatcaagaatccggcttggctctaa

DBGET integrated database retrieval system