KEGG   Brassica rapa (field mustard): 103843415Help
Entry
103843415         CDS       T03449                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp03030  DNA replication
brp03410  Base excision repair
brp03420  Nucleotide excision repair
brp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:brp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    103843415
   03410 Base excision repair
    103843415
   03420 Nucleotide excision repair
    103843415
   03430 Mismatch repair
    103843415
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:brp03032]
    103843415
   03400 DNA repair and recombination proteins [BR:brp03400]
    103843415
Enzymes [BR:brp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103843415
    6.5.1.6  DNA ligase (ATP or NAD+)
     103843415
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103843415
DNA replication proteins [BR:brp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103843415
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103843415
DNA repair and recombination proteins [BR:brp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103843415
   NER (nucleotide excision repair)
    Other NER factors
     103843415
   MMR (mismatch exicision repair)
    Other MMR factors
     103843415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 103843415
NCBI-ProteinID: XP_009118391
LinkDB All DBs
Position
A9
AA seq 803 aa AA seqDB search
MLAIRSSNHFRCISSLCTKTRFSSVLVSLNRQVSPFPSSSRLHHRAMSSSRPSAFDALMS
NARASAKKKTTPQASNSSPSPNKRKISKTQDADSPKAEAFSDSPKPRSDSPSIAEDLKKG
AKTQDADLTKVEAFSDSAKPRSSIAKKSRTLSQTDKVDELKSRIVLLKRKPGEFDPERVA
CWEKGERVPFLFVALAFDLVSAESGRIVITDILCNMLRTVIATTPDDLVAAVYLAANEIA
PAHEGVELGIGEGSIIKAISEAFGRTEAQVKKLNTELGDLGLVAKGSRSSQTMMFKPEPL
TVVKVFNTFRQIAKESGKDSTEKKKDRMKALLVAATDCEPLYLTRLLQAKLRLGFSNQTV
LAALGQAAVYNEEHSKPPPKTKSPLEEAAKIVKQVFTVLPVYDIIVPALLTGGVWNLPKT
CNFTLGVPIGPMLAKPTKGVGEIINKFQDTVFTCEYKYDGERAQIHCMEDGTFEIYSRNA
ERNTGKYPDVALALSRLKKPSVKSFILDCEVVAFDREKKKILPFQILSTRARKNVNVNDI
KVGVCIFAFDMLYLNGQQLIQENLDIRREKLYGSFEEDPGYFQFATALTSSDIDEIQKFL
DASVDIGCEGLIIKTMNSDATYEPAKRSNNWLKLKKDYMDSIGDSVDLVPIAAFHGRGKR
TGVFGAFLLACYDADKEEFQSICKIGTGFSEAVLEERSTSLRSRVIPTPKQYYRVGDSLN
PDVWFEPTEVWEVKAADLTISPVHRAANGIVDPDKGISLRFPRLLRVREDKKPEEATSSE
QIADMYQAQKHNHPSNEGKGEDD
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgttagcgattcgatcatcgaatcacttccgatgcatttcttctctctgcactaaaact
cgattctcctccgtattagtctctctcaatcgccaagtttccccctttccctcctcctcg
cgcctccaccacagagcaatgtcttcttctcgcccctctgcattcgacgctctcatgtcc
aacgctcgcgcttccgccaagaagaaaacgactccccaagcttccaattcatctccctcc
ccgaacaaaagaaaaatctcgaaaacccaagacgccgattcgccaaaggcggaagctttt
tccgattcccccaaacccagatcagattcgccgtcaattgcggaagatttgaagaaggga
gcgaaaacccaagacgccgatttgacaaaggtggaggctttttccgattcggctaaaccc
agatcgtcaattgcgaaaaagtctaggactttgagtcagacggataaagtcgacgaattg
aagagtaggattgtgttgctgaagaggaagcctggcgaattcgatccggagagagtggcg
tgttgggagaaaggggagagagttccgtttttgtttgtggcattggcgtttgatttggta
tcagctgagagtgggaggattgtgattactgatattttgtgtaacatgttgaggactgtt
attgccaccactcctgatgatttggtcgctgctgtttatcttgcggcgaatgagattgct
cctgctcatgaaggggtggagttggggattggtgaaggttctattattaaggccatctct
gaagcttttggtagaactgaggcgcaggttaagaagctgaatacggaactgggagacttg
gggcttgtagcaaaaggaagccgttcgtctcagactatgatgttcaagccagaaccattg
actgttgtcaaggttttcaatacttttcgacaaattgctaaggaaagtgggaaagatagt
acagaaaagaagaaggatcggatgaaggcacttcttgtggcagctacagactgtgaacct
ctctacttaactcgtttacttcaggcaaaattgcggttagggttctcaaatcagactgtc
ttagctgccttgggacaagcagctgtttataatgaagaacactcaaagccacccccaaaa
accaagtctcctttagaggaggctgcgaagattgttaagcaagtattcactgtgcttcct
gtgtatgacattatagttcctgctcttctaactggtggtgtgtggaatcttcctaaaact
tgtaacttcacacttggtgttcctattggaccaatgcttgcaaaaccaacaaaaggtgta
ggcgagataattaataaattccaggacacagttttcacatgcgaatacaaatatgatgga
gaacgtgcacagatacattgtatggaggatggtacattcgagatatatagtcgaaatgct
gaaaggaacactggaaagtaccctgatgttgctcttgcgttatcaaggttaaagaagccc
tctgtgaaatcttttatcctggattgtgaggttgttgctttcgatagagagaaaaagaag
attcttccgtttcagattctgagcactcgagcgcgtaagaatgtgaacgtcaatgatatc
aaagttggcgtatgcatctttgcttttgacatgttatatctaaatggacagcaacttatc
caggaaaatcttgatattcgccgagagaagctgtacggatcatttgaggaagatcctgga
tatttccagtttgcaactgctctaacatccagcgatatcgatgaaatacaaaagtttctt
gacgcttctgttgacattgggtgtgaagggttaatcattaaaacaatgaattcagatgcg
acatatgagcctgcaaagcgatcgaataattggttaaaactgaagaaagactatatggac
agcattggggattctgtggatcttgtaccaattgctgctttccatggacgtggcaaacgc
acaggtgtctttggtgcattcttactagcttgctatgatgctgataaggaagagttccag
agcatttgtaaaataggtactggattttctgaagctgtgcttgaagaacggtctacgagt
cttcggtccagagtgattcctactcctaaacaatactaccgagttggagacagtctcaat
ccagatgtttggtttgagcccactgaggtctgggaagtgaaggcagctgacttgacaatt
agccctgtgcatcgtgcagccaatggaattgtggatcctgataagggaatttctctacgt
tttcctcgtttactccgtgtacgggaagacaagaagccagaggaagcaacatcatctgaa
cagattgctgatatgtaccaagctcaaaaacacaaccatccaagcaatgaaggcaaaggt
gaagatgattga

DBGET integrated database retrieval system