KEGG   Brassica rapa (field mustard): 103847604Help
Entry
103847604         CDS       T03449                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial-like
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00564  Glycerophospholipid metabolism
brp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103847604
Enzymes [BR:brp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     103847604
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 GIDA HI0933_like Pyr_redox 3HCDH_N Pyr_redox_3 NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 103847604
NCBI-ProteinID: XP_009122946
LinkDB All DBs
Position
A1
AA seq 630 aa AA seqDB search
MSVSSLRRLAVSAAVIAAASGGAVYLSPSVASSDRAGGGPVLDSLKRTLGDPSASVPSRS
AQESALIKATSSNPLDVLVIGGGATGSGVALDAATRGLRVGLVEREDFSSGTSSRSTKLI
HGGVRYLEKAVFNLDYGQLKLVFHALEERKQLIENAPHLCHALPCMTPCFDWFEVVYYWM
GLKMYDLVAGPRLLHLSRYYSAQESAELFPTLARKGKDKSLRGTVVYYDGQMNDSRLNVG
LACTAALAGAAVLNHAEVVSLITDDDTKRIVGARVRNNLTGKEFESYARVVVNAAGPFCD
SIRKMVDEDTKPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTT
DSNTSITPLPEPHEDEIQFILDAISDYLNIKVRRTDVLSAWSGIRPLAMDPTAKSTESIS
RDHVVFEEHPGLVTITGGKWTTYRSMAEDAVNAAIKSGKLSPTNGCVTQKLQLLGSHGWE
PSSFTALAQQYVRMKKTYGGKVVPGAMDTAAAKHLSHAYGSMAERVAIIAQEEGLGKRLA
HGHPFLEAEVAYCARHEYCESAVDFIARRCRIAFLDTDAAARALQRVVEILASEHKWDKS
REKQEMQKAKEFLQTFKSSKNAQFHDGKHN
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtctcttccctccgccgtctagccgtctccgccgccgtaatcgccgctgcatcc
ggcggcgccgtctacctctccccctccgttgcctccagcgacagagccggcggcggtccg
gttctagattcgttgaaacgtactctcggcgatccctcagcctccgtaccgtctcgatcc
gctcaagagtctgctctcatcaaagccacctcttctaatccgctcgacgtcctcgtgatt
ggcggtggagccaccggctctggagtggctctcgacgctgcgacacgtggcctccgcgta
ggtctcgtggagcgtgaggatttctcctcagggacgtcttcacgttcaacgaagctaatc
catggaggagttcgttacttggagaaagctgtgttcaatctcgactacggacagctgaag
cttgtcttccacgcgctcgaggagcgtaaacagctcatcgagaacgcgccccatctctgc
cacgcgctcccttgtatgacaccttgtttcgactggttcgaagtggtctactactggatg
gggctgaagatgtacgacttggtggcgggaccgcggttgttgcatctgtctaggtactac
tctgcgcaagagtctgctgagctcttccctactctcgcgaggaaagggaaggacaagagc
ttgagggggactgttgtgtattacgacgggcagatgaatgattcgcgtttgaatgttggg
ttggcgtgtactgctgctttagctggtgctgcggttctcaaccatgctgaggttgtctcg
cttattacggatgatgataccaagagaatagttggtgccagggttcgtaacaatctcaca
ggcaaagagtttgagagctatgcgagagtagtagttaatgcggctggaccgttctgtgat
tccataaggaagatggttgatgaagatacaaagcctatgatatgtccaagcagcggtgta
cacattgttctccctgattactattcaccagaagggatggggttgatagttcctaaaact
aaggatggtcgtgttgtgtttatgttaccgtggttgggaagaacagttgccgggactaca
gactctaacacgtcgatcactccgcttccagaacctcatgaggacgagattcagtttata
cttgatgcaatcagtgactatcttaacattaaggttcgacgtactgatgttctctcggct
tggagtggtatacgtccattggctatggatccaacggcaaagagcacagagagtatctca
agagaccacgttgtcttcgaggaacatcctggtctggtcactatcactggtggaaaatgg
actacttatcgaagtatggctgaagatgcggttaatgcagcaatcaaatcagggaagctg
agtccaaccaatggatgcgtaacacagaagctacagcttcttggttctcatggatgggaa
ccatcttctttcacagctcttgcgcagcaatacgtgcgcatgaagaaaacatatggtggt
aaagtggttcctggagcaatggacacagctgctgcaaagcatttgtctcatgcctatggt
tcgatggctgaaagagtcgccatcatagctcaggaggagggtttggggaaacggttggcg
catggacatccgtttcttgaagcagaggttgcgtactgtgcaaggcacgagtactgcgag
tcagcggttgattttatagcgaggagatgtagaatagcgttcttggacacagacgcggcg
gcgagggcgttgcagcgtgtggtggagattctagcgagtgaacacaagtgggacaagtcg
agggagaagcaggagatgcagaaggctaaagagtttcttcagacattcaagtcttccaaa
aacgcacagtttcacgatggcaaacacaactga

DBGET integrated database retrieval system