KEGG   Brassica rapa (field mustard): 103851555Help
Entry
103851555         CDS       T03449                                 

Definition
(RefSeq) UDP-galactose/UDP-glucose transporter 5B
  KO
K15276  solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2
Organism
brp  Brassica rapa (field mustard)
Brite
KEGG Orthology (KO) [BR:brp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:brp02000]
    103851555
Transporters [BR:brp02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   103851555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UAA EamA TPT
Motif
Other DBs
NCBI-GeneID: 103851555
NCBI-ProteinID: XP_009126670
LinkDB All DBs
Position
A2
AA seq 343 aa AA seqDB search
MAEPETVNGVKENKLWKGVFAVSGIMSTLVIYGVLQEKIMRVPYGLNKEFFKYSLFLVFC
NRLTTSAVSAGALLASKKVLDPVAPVYKYCLISVTNILTTTCQYEALKYVSFPVQTLAKC
AKMIPVMVWGTLIMQKKYKGFDYLVAFLVTLGCSVFILFPAGDDVSPYNKGRENTVWGVS
LMAGYLGFDGFTSTFQDKLFKGYNMEIHNQIFYTTLCSCVLSFTGLTLQGQLLLAVDFVS
RHRDCLVDIALLSTVATASQFFISYTIRTFGALTFAAIMTTRQLASIMLSCIWFSHPLSW
EQCIGSVIVFGSLYAKNLLNNNKRTETQPPPPELPQYEKPEGS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggctgagccggagacagtaaatggagtgaaggagaacaagttatggaaaggtgtgttc
gcggtttcagggattatgtcaactcttgtcatctatggtgttcttcaggagaagataatg
agagttccttatggattgaacaaagagttctttaagtactctttgtttcttgttttctgt
aatcgtctcactacttcagctgtttctgctggtgctttactggcaagcaagaaagttttg
gatcctgtagctccggtttataagtattgccttatttcagtgactaacatcttaaccaca
acatgccaatatgaggctctcaagtatgtgagcttcccggtccaaactctagctaaatgt
gccaaaatgataccagttatggtatggggaactctcatcatgcagaaaaagtacaaggga
tttgactacctagttgctttcttggttaccctgggctgctctgtcttcattcttttcccg
gcaggagatgatgttagtccgtacaataagggaagggagaatactgtttggggtgtttcc
ttaatggctggttatcttgggtttgatggctttacaagcacattccaagacaaactcttt
aaaggatataatatggagatacataaccaaatattctacacaacactttgttcttgtgtt
cttagtttcactggacttacattgcaaggccagttactactagctgtagattttgtttct
cggcatagagattgtttagtggacatcgccctgctttccacagttgcaacagcgagccag
ttcttcatttcttacaccattaggacatttggtgctctaacatttgctgcaatcatgacg
acgagacagcttgcaagcatcatgctctcatgcatttggttctctcatccgcttagctgg
gagcaatgtatcggatcggtcattgttttcgggtctttatacgcgaaaaacttactaaac
aacaacaaaagaacagaaacgcaaccgccgcctccagaacttccgcagtatgaaaagcct
gagggctcttaa

DBGET integrated database retrieval system