KEGG   Brassica rapa (field mustard): 103852368Help
Entry
103852368         CDS       T03449                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain 1B, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00630  Glyoxylate and dicarboxylate metabolism
brp00710  Carbon fixation in photosynthetic organisms
brp01100  Metabolic pathways
brp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    103852368
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103852368
Enzymes [BR:brp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     103852368
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 103852368
NCBI-ProteinID: XP_009127518
LinkDB All DBs
Position
A2
AA seq 181 aa AA seqDB search
MASVMLSSATMASSPAHATMVAPFIGLKSSAAFPVTCKANTKVTSITSNGGRVNCMKVWP
PVGKKKFETLSYLPDLTDVEIAKEVDYLIRNKWTPCIEFELEHGFVYREHGNIPGYYDGR
YWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAFIRIIGFDNNRQAQCISFIAYKPPSFTD
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgttatgctctcttccgctacaatggcctcttctccggctcatgccacaatg
gtcgcaccattcatcggacttaagtcctctgctgctttcccagtgacatgtaaggcgaac
accaaagttacttccatcacaagcaacggcggaagagttaactgcatgaaggtgtggcct
ccagttggcaagaagaagtttgagactctctcttaccttcctgaccttaccgatgtcgaa
atagccaaggaagttgactaccttatccgcaacaagtggactccatgtattgaattcgag
ttggagcacggttttgtataccgtgagcatggaaacatccctggatactatgatggacga
tactggacaatgtggaagcttcctttgttcggatgcactgactcagctcaggtgttgaag
gaagtgcaagaatgcaaaaaggagtaccccaacgccttcattaggatcatcggattcgac
aacaatcgtcaagcccagtgcatcagtttcatcgcctacaagccaccaagcttcactgat
gcttaa

DBGET integrated database retrieval system