KEGG   Brassica rapa (field mustard): 103855926Help
Entry
103855926         CDS       T03449                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00052  Galactose metabolism
brp00500  Starch and sucrose metabolism
brp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103855926
   00500 Starch and sucrose metabolism
    103855926
Enzymes [BR:brp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103855926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 103855926
NCBI-ProteinID: XP_009131225
LinkDB All DBs
Position
A3
AA seq 891 aa AA seqDB search
MSPTQWLPTILTVVFFFLSLASPSHGSSQVGYGYIVSSVAVDSNQKVLTAKLDLIKPTSV
YAPDVQTLNLHVSLETSERLRIRVTDSTQQRWEIPETVIPRAVTHSPRRYLTEENNTLED
PSSDLVFTLHKTTPFGFSVSRRSSGDVLFDASLDPSDPNTYFVFKDQFLQLTSALPESRS
NLYGLGEHTKRSFKLIPGDALTLWNADIGSENPDVNLYGSHPFYMDVRGSNGHDEAGMTH
GVLLMNSNGMDVRYDGSRITYNVIGGIIDLYVFAGPSPEMVMDQYTEFVGRPAPMPYWSF
GFHQCRYGYNNVSDLESVVDGYAKAGIPLEVMWTDIDYMDGYKDFTLDPVNFPEDKMKSF
VDTLHKNGQKYVLILDPGIGVNSSSYGTYNRGMEADVFIKRDGEPYLGEVWPGKVYYPDF
LNPAAATYWSNEIKMFLETLPVDGLWLDMNELSNFITSPLSPGSSLDDPPYQINNLGGKA
SINKKTVPATAIHFGNVSEYDAHNMYGLLEAKATHQAVEDITGKRPFLLSRSTFVSSGKY
TAHWTGDNAAKWEDLAYSIPGILNFGLFGIPMVGADICGFSDDTTEELCRRWIQLGAFYP
FARDHSSKGTARQELYLWDSVAASARKVLGLRMRLLPHLYTLMYEAHVSGVPIARPLFFS
FPRDTNTYEISSQFLIGKSIMISPALEKGTVSVDAYFPAGNWFDMFNYSFAVGGSSGKRV
SLDTPADHVNVHVREGSIVAMQGEAMTTREARTKPFELLVVASKLENISGQLFLDDGENI
RMGEEGGNRDWTLVKFRCYVNGKSVVLRSEVVNPEYASRMKWSIGKVTFVGFENAESVKT
YEVRTGERLRGPRISLLKTVVDDDDPKFMSVEVSRLSLLVGKKFEMRLKLT
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgtcacctactcagtggctacccactatcctcaccgtagtcttcttcttcttgagctta
gcttcaccctcacatggaagctcacaagttggatacggctacatcgttagctcagtggcc
gttgattccaaccagaaggtcttgacggcgaagcttgatctgatcaaaccaacgtccgtt
tacgcaccagacgttcaaacgctaaaccttcatgtcagcttggagacaagtgagcgtttg
agaatcagagtaacagactctactcaacagagatgggagataccggaaaccgttatccct
cgcgccgtaacccactctcctcgccgttacttaacggaagagaacaataccttggaagat
ccatcatcggacttagttttcacactccacaaaacgacgccgttcggtttctccgtctcc
agacgctcctccggcgacgtcctcttcgacgcgtcgctggatccatcggatccgaacacc
tacttcgtcttcaaagaccagttcctccaactaacctccgccttaccggaatcccgatcg
aatctgtacggtctcggagaacacacgaagcgatcgttcaagctgatcccgggagatgca
ttgactctgtggaacgctgacatcgggagtgagaatccggatgttaacctgtacggatcg
catccgttttacatggacgtgagaggatctaacggtcacgatgaagcggggatgactcac
ggcgttctattgatgaacagtaatggaatggatgtgaggtatgatggaagtcggattacg
tataatgtgattggtggtatcattgatctctacgtgttcgccgggccttcgccggagatg
gtgatggatcagtatacagagtttgttggaagacctgcacctatgccttattggtcattt
ggattccatcagtgtcggtatggatacaacaatgtgtcagaccttgaatctgtggttgat
ggatatgcaaaagctggaatacctcttgaggttatgtggactgacatagactacatggat
ggctacaaagactttactttggacccggtgaacttcccggaggacaagatgaaatcattc
gtggatacacttcacaagaacggtcagaagtacgtgctgatcttggatccaggtattggt
gtgaatagctcctcttacgggacatataacagaggaatggaagcagatgtgttcataaaa
cgagatggtgagccttatctcggtgaggtttggcctgggaaagtatactaccctgacttc
ttgaatccagctgctgcaacttactggagcaacgaaatcaagatgttcttggaaactctc
cctgtggatggtctgtggcttgacatgaacgagttgtcaaatttcataacttcacctctg
tcccctggatcttcactcgatgatcctccttaccagatcaacaacttagggggcaaagct
tctataaataagaagacagtacccgcaacagctatccattttgggaacgttagtgaatac
gacgcgcataatatgtatggactcttggaagctaaagccactcaccaagctgtggaggat
ataacgggaaagagaccgtttcttttgtcgagatccacgttcgtaagctcggggaagtac
acagctcattggacaggagataacgctgccaaatgggaggacttggcttactcgatcccg
gggatactcaactttggactgtttgggatcccaatggttggagctgacatctgtggtttc
tcagatgataccaccgaggagctatgtcgtcgatggatccagcttggagcgttttaccct
tttgcaagagatcattcgtccaaaggtactgctagacaagaactatacctatgggattcg
gttgctgcttccgcaagaaaggttctcggccttcgtatgagactcctcccacatctatac
acactaatgtacgaggctcacgttagtggcgtccctatagcgcggccactcttcttctcc
ttccctagagacactaacacctatgagatcagctcgcagttcttgatcggtaaaagcata
atgatatctcccgcgctggagaaagggacagtgtccgtcgatgcatatttccccgcaggg
aactggttcgacatgtttaactattcgtttgccgtcggtggaagttctggcaagcgtgtt
agtcttgatactcccgccgatcacgtcaatgttcatgttcgagaaggtagcattgtggct
atgcaaggagaagcaatgacgacaagagaagccagaacgaaaccgtttgagcttctagtt
gtagcaagcaagcttgagaacatctccggccagctgtttctcgatgatggcgaaaacata
cggatgggagaggaaggagggaaccgtgattggaccctggtgaagttccgatgctacgta
aacggaaaatccgtggtgctgagatcagaagtggtgaacccagagtacgcgtctaggatg
aaatggagcatcgggaaagtgacgttcgttgggtttgagaatgcggagagcgtgaaaacg
tacgaggttaggacaggggagaggttgagagggccgagaatctctcttctcaagacggtt
gtggacgatgatgatcccaagtttatgagtgtggaggtgtccagattgtccttgcttgtt
gggaagaagttcgagatgcgattgaaattgacttaa

DBGET integrated database retrieval system