KEGG   Brassica rapa (field mustard): 103861548Help
Entry
103861548         CDS       T03449                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP53
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
brp  Brassica rapa (field mustard)
Brite
KEGG Orthology (KO) [BR:brp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:brp03009]
    103861548
Enzymes [BR:brp01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     103861548
Ribosome biogenesis [BR:brp03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    103861548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C NPL Nucleoplasmin Mitofilin
Motif
Other DBs
NCBI-GeneID: 103861548
NCBI-ProteinID: XP_009137516
LinkDB All DBs
Position
A3
AA seq 459 aa AA seqDB search
MVFWGIEVKPGKPQAYNPENEQGTLHLTQATLGAGLGKEKSVIQCSIGGNAPVYLCSLLP
NKSECCPLNLEFDDNDEAVEFSVTGDRSIHLSGFLQAYDEEEEECGVDDYEDDSDGIDIG
DTESGESEFDSEEDEDHMDEFEDFIDHNLDMYRQSSVPNSGVVIEEIEDEEKPATDDKTK
RSKKKSKASKDESANKQIVVKESAHAPVLESEDEDGLPILKEKTPETEKKSAAKMDVDDV
EQGSNKKRKAKAPEQESVNKNKKKKNQKEKKNEESASKGEADEKAETEDVLKKEETSQSS
SNPKAQNGAANNAMSENSKTPVESAEKKKKKKKKSNEEAKEESKAISSRTYPNGLVVEEI
RMGKPNGKKATPGKQVSVCYTGKLQKNGEVFDSNKNGFKFRLGVGQVIKGWDVGVNGMRI
GDKRKLTIPPSMGYGAKGAGGDIPPNAWLTFDVELLDVK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggtgttctggggaatcgaagtgaagcctgggaagcctcaagcttacaatcccgaaaac
gagcaagggacgctacacctcacccaggcaactctaggtgctggtttaggcaaagagaag
agtgtgatccaatgctccataggaggaaacgcacctgtttacttgtgttcgttgttgcct
aacaaatccgaatgttgccctctgaatcttgagtttgacgataacgacgaggcggttgag
ttctccgtgactggtgacagaagcatccacctttctggattcttgcaggcttatgatgag
gaggaggaggagtgtggggtggatgattatgaagatgattcagatggtattgatattggt
gacactgagtctggagagtctgagtttgatagtgaagaggatgaggatcatatggatgaa
tttgaggatttcattgatcacaatcttgatatgtatcggcaatcttctgtcccaaacagt
ggagttgtaattgaggagatagaagatgaggagaagcccgccacagatgataagacaaag
cggtccaagaagaagagtaaagctagcaaagatgagagcgcaaataagcaaatcgttgtc
aaggagagcgcccatgctccagttctggaaagcgaagatgaagatggtttacctattctt
aaagagaaaacacctgaaacagagaagaagtctgctgcgaagatggacgtagatgatgtc
gaacaaggtagcaacaaaaaacgcaaggccaaggctcctgagcaagaaagtgtaaacaag
aacaaaaagaagaaaaatcagaaagagaagaagaatgaggaaagtgcctcgaaaggggaa
gctgatgaaaaagctgagacggaagatgtgctgaaaaaggaggagacgagccaaagttct
tcaaacccaaaagctcaaaatggagctgctaacaatgccatgagtgaaaactccaagact
ccagttgaatctgctgagaagaaaaagaaaaagaaaaagaagtcaaatgaggaagctaaa
gaagagagcaaagctatttctagtaggacatacccaaatggactcgttgttgaggagata
cgcatgggcaaacccaacggcaagaaagctactcctggaaagcaggttagtgtctgctac
acaggaaaacttcagaagaatggggaggtcttcgattccaataaaaatggttttaagttc
cgtctaggtgttggacaggtcattaagggatgggatgttggtgttaacggaatgaggatt
ggtgacaaaagaaagcttacaattccaccatcaatggggtacggtgctaagggtgctggt
ggcgatattcctcctaatgcttggttgacgtttgacgtcgaactgttggatgttaagtaa

DBGET integrated database retrieval system