KEGG   Brassica rapa (field mustard): 103864466Help
Entry
103864466         CDS       T03449                                 

Gene name
curly
Definition
(RefSeq) histone-lysine N-methyltransferase CLF
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:brp00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103864466 (curly)
Enzymes [BR:brp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103864466 (curly)
Chromosome and associated proteins [BR:brp03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103864466 (curly)
   Polycomb group proteins
    PRC2-EZH2 complex
     103864466 (curly)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TCR
Motif
Other DBs
NCBI-GeneID: 103864466
NCBI-ProteinID: XP_009140462
LinkDB All DBs
Position
A4
AA seq 909 aa AA seqDB search
MASGASPSSSATRSDPHKHSTTSQAEKRAPASKEVSAVIDSLKKKLAADRCISIKRRIDE
NKKNVRGITQSTMRSCMERGGGSYKDGSDLLVKRQRDSPGMKSGVNASDADKSNNHSSFL
EDGNASSTTMVQGSSVPVKISLRPIKMPDVKRLSPYTTWVFLDRNQRMTEDQSVVGRRRI
YYDQTGGEALICSDSEEEAIDEEDEKRAFLEPEDFIIRMTLDQLGLSDSVLEELANFLSR
SSSEIKARYEVLMKEKEVSESGDNQAESSLLNKDMDGALDSFDNLFCRRCLVFDCRLHGC
SQDLIFPAEKPAPWTPPVDENLTCGANCYKTLLKSNRIPANGTTEDKTGTSSDGAGTKTT
SKFSGKLNRKKTKTFPSESASSNEKCTPETSDSENGVQQDTNPEKVSSTSKVKASGRRGG
RKRNNNRVAERVSRRTQKRQKKSEASDTDSIATGSRSASDAKHKDNEDATSSSQKHVKSG
SSKNSRKNDTPVDDSKNSVKGDDPVSQLNAVASEPCSDGSLRKEEFVGENVCPGGLSEDK
SWRPLEKSLFQKGVEIFGMNSCMIARNLLCGLKSCWEVFQYMTCSENKASFFGGDALNPD
GSSKFDINGNMTNNQVRRRSRFLRRRGKVRRLKYTWKSAAYHSIRKRSTDKKDQPCRQFN
PCNCKTACGKECTCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCPCFAADRECD
PDVCRNCWVIGGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLLGISDVSGWGAFLKNSVS
KHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLKFANHSPEP
NCYAKVIMVAGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWARKPEASGSKKDENVTP
SVGRPKKVA
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgggagcttcgccttcttcttccgccaccagatcggacccgcacaagcactct
acgacatctcaggcggagaagagagctccagcgtctaaggaagtttcagcagtgatagat
tcgcttaagaagaagctcgcagctgatcggtgtatctcaattaagagaaggattgatgag
aacaagaagaatgtgcgtggcatcactcaatccactatgaggtcgtgtatggagagagga
ggcggtagctataaagacggtagcgatctcttggttaagaggcaaagagattcgcctggt
atgaaaagcggagtcaatgcgagtgatgctgataagagcaacaaccatagcagcttctta
gaagatgggaatgctagttcaacaaccatggttcaagggtctagtgtccctgttaagatt
tccttgcggccgatcaaaatgcctgatgttaaacgtttgtcgccttataccacatgggtt
tttctggataggaatcaaagaatgactgaagaccagtctgttgtgggtcggaggagaatc
tattatgaccaaaccggcggggaagcactcatttgcagtgatagtgaagaggaggctatt
gacgaggaagatgaaaaaagagcttttctggagcctgaagattttattattcgcatgacc
cttgaccaactaggtctttcagactctgtcttggaggaactagcaaatttcttgtccaga
agctctagtgaaataaaggcaagatatgaagtgcttatgaaggaaaaagaagtttcagag
agtggcgataatcaagcagagagttctcttcttaacaaagatatggatggagctttggat
tctttcgacaacctgttctgccgtcgatgccttgtgtttgattgccggctgcacgggtgt
tcgcaggatcttatatttcctgctgagaaaccagctccatggactcctcctgtggatgaa
aatctaacctgtggcgctaactgctataaaacgcttctcaaatctaatagaatcccagct
aatggcaccaccgaagataaaactggcacttcatcagatggtgcgggtactaaaaccaca
tccaagttctccggcaaacttaataggaaaaaaacaaaaaccttccctagcgaaagcgcg
tcgtctaatgaaaaatgcacgccagaaacaagtgactcagagaacggcgttcagcaggat
accaatcctgagaaagtttcatcgacatcaaaggtgaaagctagtgggagacgtggaggt
cgtaagaggaacaacaaccgagttgctgagcgagtttctcgtaggactcaaaagaggcaa
aagaagtcagaagcttccgatactgattccatcgccactgggagtcgttcagcaagcgat
gcaaaacataaagataatgaagatgctacatcctcttctcagaagcatgtaaaatctggg
agctctaagaattcaagaaagaatgacactcctgtagatgactccaagaattctgtgaag
ggtgacgatcctgtttctcagttaaatgctgttgcatctgaaccgtgtagcgatggaagt
ttaaggaaagaagagtttgtgggtgaaaatgtatgtccaggaggactgtctgaagataaa
tcgtggagaccacttgagaaaagcctgttccaaaaaggtgttgagatttttggaatgaat
agctgcatgattgctaggaaccttctgtgtggtctcaagtcgtgttgggaggtcttccaa
tacatgacttgctcggagaacaaagcttccttcttcggaggtgatgcattgaatcccgac
ggctcttccaagtttgatatcaatggaaatatgactaataaccaagtgcgaagaaggtca
agatttctacgtagaagaggcaaagtgcgccgcttgaagtatacttggaagtctgctgca
tatcattcaattaggaaaagaagtaccgataagaaagaccagccgtgccgtcaatttaat
ccatgcaactgcaaaactgcttgcgggaaggaatgtacttgtttgctaaacgggacttgc
tgcgagaagtactgcggttgcccaaagagctgcaagaacaggtttagaggttgtcattgt
gccaaaagccagtgtcggagccgtcaatgtccgtgctttgctgcagatcgggaatgtgat
cctgatgtttgtaggaattgctgggtcattggtggggatggtacgcttggggtccctagc
caaagaggcgataattatgagtgcaggaatatgaaattactcctgaaacaacaacaaagg
gttttacttggaatatctgatgtatctggttggggagctttcctaaagaacagtgtaagt
aaacacgaatatctcggggaatacacaggagagctgatatcacataaagaagcagataaa
cgagggaagatatatgatcgcgagaattcctcttttctctttaatctaaatgatcagttt
gtgctagatgcttataggaaaggagacaaactgaagttcgccaatcattcccctgaacct
aactgttacgcaaaggtcattatggttgctggagatcatagagtgggtatttttgcaaag
gagaggatattggctggagaagaactgttttatgattacaggtatgagccagatcgagct
cctgcttgggccagaaaacctgaagcttcaggttctaagaaagatgagaatgttacacct
tctgttggtagacccaagaaggttgcttag

DBGET integrated database retrieval system