KEGG   Brassica rapa (field mustard): 103864828Help
Entry
103864828         CDS       T03449                                 

Gene name
CSD
Definition
(RefSeq) superoxide dismutase [Cu-Zn] 2, chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:brp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103864828 (CSD)
Enzymes [BR:brp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103864828 (CSD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 103864828
NCBI-ProteinID: XP_009140848
UniProt: A0A397ZLP7
LinkDB All DBs
Position
A4
AA seq 207 aa AA seqDB search
MASHTFLSFSSPPRLLVSPPSTLRSPFVGVSLNLHRPQSVSFSASKKSLTVVSAAKKAVA
VLKGNSDVEGVVTLTQDDSGPTKVSVRITGLTPGPHGFHLHEFGDTTNGCISTGPHFNPN
NMTHGAPEDEIRHAGDLGNIIANADGVAETTLVDNQIPLTGPNSVVGRAFVVHELKDDLG
KGGHELSLTTGNAGGRLACGVVGLTPL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcacaccttcctctccttctcatcgcctccgcgcctcctcgtttcccctccc
tccactctccgttcccctttcgtcggcgtctctctcaacctccaccgtccccagtccgtt
tccttctccgcctcgaagaaatcgctgacagtcgtttccgccgcgaagaaagctgtcgct
gtgctcaagggtaactccgacgtcgaaggagttgttactttgacacaagatgactcaggt
ccgacaaaagtgagtgttcgtatcaccggtctcacaccagggcctcatggctttcacctc
catgagtttggtgatacaacaaatggatgcatctcaacagggccacatttcaaccctaac
aacatgacacacggagctcctgaagacgagatccgtcatgcgggtgacctgggaaacatt
attgccaacgccgatggcgtggcagaaacaacacttgtggacaatcagattcctctgact
ggtcctaactctgttgttgggagagcctttgtggttcacgagcttaaggatgacctcgga
aagggtgggcatgagcttagcctgaccactggaaacgcaggcgggagattggcatgcggt
gtggttggtttgacgccgctctaa

DBGET integrated database retrieval system