KEGG   Brassica rapa (field mustard): 103865958Help
Entry
103865958         CDS       T03449                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00620  Pyruvate metabolism
brp00710  Carbon fixation in photosynthetic organisms
brp01100  Metabolic pathways
brp01200  Carbon metabolism
Module
brp_M00168  CAM (Crassulacean acid metabolism), dark
brp_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
brp_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
brp_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    103865958
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103865958
Enzymes [BR:brp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     103865958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 103865958
NCBI-ProteinID: XP_009142075
LinkDB All DBs
Position
A4
AA seq 964 aa AA seqDB search
MATGSLKKMGSIDAQLRLIAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEEVREFVQEC
YEVAADYDGNRNTAKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK
KLKKGDFADEASATTESDIEETLKRLLQLNKTPEEVFDALKNQTVDLVLTAHPTQSVRRS
LLQKFGRIRDCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYFSQIEDLMFEMSMWRCNEELRVRAEVQRCAKRDAKHYIEFWKQIPS
NEPYRAILGDVRDKLYNTRERARQLLSSGVSDIPEDSVFTSVDQFLEPLELCYRSLCDCG
DRPIADGSLLDFLRQVSTFGLALVKLDIRQESDRHTDVLDAITQHLGIGSYKEWSEEKRQ
EWLLSELSGKRPLFGHDLPKTEEIADVLDTFKVISELPHDSFGAYIISMATAPSDVLAVE
LLQRECGITHPLRVVPLFEKLADLENAPASVARLFSIEWYRNRINGKQEVMIGYSDSGKG
AGRLSAAWQLYKTQEELVKVAKEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGQ
LRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRVLMDEMAVIATEE
YRSVVFKEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFH
LPVWLGFGSAFKRVIQKDAKNLNMLKEMYNQWPFFRVTIDLVEMVFAKGDPGIAALYDRL
LVSEELQPFGEQLRVNYQETRRLLLQVAGHKDILEGDPYLRQRLQLRDPYITTLNVCQAY
TLKQIRDPSFHVKVRPHLSKDYMESSKPAAELVKLNPKSEYAPGLEDTVILTMKGIAAGM
QNTG
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggctaccggaagtttgaagaagatgggttccattgatgctcagctcaggcttattgct
cctgctaaggtctctgaagacgacaagcttgtggagtacgatgctctcttgctggatcgg
tttctcgatattctccaggatttgcatggcgaagaagtcagagaattcgttcaagaatgc
tacgaggtagctgcggattacgacgggaaccgcaacactgctaagctagaggagctcgga
aacatgctgacgtctctggacccaggagactcaatcgttgtcacaaagtcattctccaac
atgcttagcttggctaacttggccgaggaagtccagattgcgtacaggcgcaggatcaag
aagcttaaaaaaggagacttcgctgatgaggcctccgcaacaacagaatccgatattgaa
gagactctcaagaggctgttgcagcttaacaagacccctgaagaggtctttgatgctctc
aagaaccagactgttgacttggtcttgactgctcatcctactcaatctgttcgccgctct
ttgctccaaaagtttggaaggattcgtgattgcttaacacagttatatgcaaaagacatt
actcctgatgataaacaagaactcgatgaagctctgcaacgagagattcaagctgctttc
cgcacggatgagattaggagaactccacctacaccgcaagatgagatgagagcagggatg
agttacttccacgagacaatctggaaaggagttcctaaattcttgagacgcgttgatact
gctctgaagaacattggaatcaacgagcgtgttccttacaatgcacctctcattcagttc
tcttcttggatgggtggtgaccgtgatggaaaccctcgagtgactcctgaagttacaaga
gatgtatgcttactagcaagaatgatggctgctaatctctacttctcccagattgaagat
cttatgtttgagatgtctatgtggcgttgcaatgaagagcttcgtgtacgtgcagaagtt
caaaggtgtgccaaaagagatgcaaaacactatatagagttttggaaacaaatcccttca
aatgagccgtacagagctatactcggagacgttagagacaaactctacaacacacgtgag
cgtgcgcgccagctcttgtcaagtggagtctcagacattcctgaagactcggtgttcact
agtgtggaccagttcttggagccgcttgagctttgttacaggtcgctatgcgactgcgga
gacagacctatagccgatggaagcctgctagacttcttgcgtcaagtgtctacatttggt
ctggcccttgtgaagctcgacatccgtcaagaatccgaccgtcacaccgatgtcttagac
gccatcacgcagcacttaggcatcggttcttacaaagaatggtcggaggagaaaagacag
gagtggctcttatccgagctgagcgggaaacgccctctcttcggacacgatcttcccaaa
accgaagagatcgctgacgtgttggacacgttcaaagtcatctccgagcttcctcacgat
agcttcggcgcgtacatcatctcaatggccactgctccctcagacgtcctcgctgtcgag
cttttacaacgtgaatgtggaatcactcaccctctgagagtcgtccccttgttcgagaag
ctagctgatctagaaaacgctcctgcttccgtcgcgcgtctcttctccatagagtggtac
aggaaccggatcaacggcaagcaagaggtcatgatcgggtactcagactcaggcaaaggc
gcgggacgtttatccgcggcgtggcagctgtacaagacacaagaggagctggtgaaggtg
gcaaaagagtacggagtgaagctgactatgtttcacgggagaggtgggactgtggggaga
ggtggcgggcctacgcatcttgctatcttgtctcagccgccggatacgatccacgggcag
cttagggtgacggtgcaaggggaagttattgagcagtcttttggagaagagcatttgtgt
ttcaggactcttcagcgtttcactgctgctacacttgagcatgggatgcatccgcctgtt
tctcctaagcctgagtggcgtgtgcttatggatgagatggctgtgattgctactgaggag
tatcggtctgttgtcttcaaggagcctcgtttcgtagagtacttccgtctggcaacacct
gagcttgagtatggaaggatgaacataggaagcagaccatcaaagcgaaaaccaagcgga
ggcattgagtctctacgtgcaatcccatggatctttgcctggactcagacaaggttccac
ttgccggtatggctaggctttggatcagcgttcaaacgcgtgatccagaaggacgccaag
aatctcaacatgctcaaagagatgtacaaccagtggcctttcttccgcgtcacaatcgat
ctagtcgaaatggttttcgccaaaggagaccctggaatcgctgctctctacgaccgtctc
ctcgtctctgaagagcttcaaccctttggtgaacagcttcgtgttaactaccaagagacc
agacgtctcctcctccaggtggctggtcacaaggacattcttgaaggtgatccctacctg
aggcaaaggctgcagctacgtgacccgtacatcaccacgttgaacgtgtgtcaagcctat
actctcaagcagatccgtgacccgagcttccatgttaaagtgaggccacacttgtctaaa
gactacatggagtctagtaaaccagcggctgagctagttaagctgaatcctaagagtgag
tacgcacctggacttgaagacactgttatccttaccatgaagggtatagccgccggtatg
cagaataccggttaa

DBGET integrated database retrieval system