KEGG   Brassica rapa (field mustard): 103867868
Entry
103867868         CDS       T03449                                 

Definition
(RefSeq) calcium-dependent protein kinase 24-like isoform X1
  KO
K13412  calcium-dependent protein kinase [EC:2.7.11.1]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:brp00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    103867868
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:brp01001]
    103867868
Enzymes [BR:brp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103867868
Protein kinases [BR:brp01001]
 Serine/threonine kinases: CAMK group
  CDPK family
   103867868
SSDB
Motif
Pfam: Pkinase EF-hand_1 PK_Tyr_Ser-Thr EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 APH Kdo tRNA_synt_1c_R1 Pkinase_fungal
Other DBs
NCBI-GeneID: 103867868
NCBI-ProteinID: XP_009144198
LinkDB
Position
A5
AA seq 610 aa
MGSCVSSPLKGSPFGKRPARRRNNSSSTKTSSNPKTDTSSTSTLSRRLIFQPPSRVLPEP
IGDGIFLKYELGKELGRGEFGVTHECIEISTRERFACKRISKEKLRTEIDVEDVRREVEI
MRSLPKHANIVSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAAASVAKTILEV
VKVCEKNSNLLCIFCFFPAFIVVFLCLKVCHEHGVIHRDLKPENFLFSNETETAQLKAID
FGLSIFFKPAQRFNEIVGSPYYMAPEVLRRNYGPEIDVWSAGVILYILLCGVPPFWAETE
EGIAHAIVRGNIDFERDPWPKVSREAKELVKNMLDANPYSRLTVQEVLEHPWIQNAERAP
NVNLGDGVRTKIQQFLLMNRFKKKVLRVVADNLPNEEIESIIQMFQTMDTDKNGHLTFEE
LRDGLKKIGQVCPDGDVKMLMDAADTDGNGTLSCEEFVTLAIHLKRMGCDEHLQQAFKYF
DKNGNGSIELDELKEALFDDDKLGHGGDQWIKDIFFDVDLNKDGRISFDEFRAMMKSGTD
WKMASRQYSRALLNALSIKMFKEDVGDNGPKSYSMEFPLARKKAKLLDAPKNKSMELVHS
KTYRPSGLRN
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgggaagctgtgtttcgtcgccattgaaaggttctccctttgggaagagacctgcaaga
aggcgaaacaacagtagtagcaccaaaacatcctctaaccctaaaaccgatacttcttcg
acaagtactctttcccggagattgattttccagccaccgagccgtgttctacccgagccc
attggtgatggaatcttcctcaagtatgagctcgggaaagaactaggccgtggtgagttt
ggtgtcactcatgaatgtattgagatcagtactcgagaaaggtttgcgtgtaagaggata
tcaaaggagaagctaaggacggagatagacgttgaggatgtgagaagagaggttgagatc
atgagatctttaccaaaacatgcaaacattgttagctttaaggaagcttttgaggacaaa
gacgcggtttatcttgtcatggagatttgtgaaggaggtgagctttttgaccgtattgtc
tctcgaggtcattacactgaacgcgccgctgcatccgtcgctaaaaccattcttgaagtt
gtcaaggtgtgtgaaaaaaattcaaatctcctttgtatcttttgtttttttcccgccttt
attgttgttttcttgtgtctcaaggtatgtcatgaacatggagtgatccatagagatctt
aagcctgagaactttctcttttctaacgaaaccgagactgcacaactcaaagctattgac
tttggtctctccattttcttcaaaccagcccagcggttcaatgagattgtggggagtcct
tattacatggcaccagaggttttgagaagaaactacggtccggagatcgatgtttggagc
gctggtgttatactctacatcttgctttgtggtgtgcctcccttttgggcagagactgag
gaaggaatagctcatgcaattgtgagagggaacatcgattttgagagagatccgtggcca
aaagtctcacgtgaagccaaagaactcgttaagaacatgcttgatgctaatccttatagc
agactcacggttcaagaagtccttgaacatccatggatccagaacgcagagagagcacca
aatgtgaatcttggagatggcgtgaggaccaagattcaacagttcttgttgatgaacagg
ttcaagaagaaagtcctcagggtagtagctgacaatctaccaaacgaggagatagaatcg
ataatacaaatgtttcagacaatggacactgataagaacggacacttgacttttgaggag
ctaagagatggtctgaagaagattggacaagtttgtcccgatggcgacgtgaagatgctt
atggatgcagctgatacagatggaaacgggacgttgagctgtgaagagtttgtgacacta
gccatacacttgaagagaatgggttgtgatgagcatttgcagcaagcattcaagtatttt
gacaagaacggtaacgggtctattgagctagatgagctcaaagaagctctattcgatgat
gataagctaggccatggtggtgaccagtggatcaaagatatcttctttgacgttgacctc
aacaaggatgggaggataagctttgatgagtttagggccatgatgaaatcaggaacagac
tggaagatggcgtctaggcagtactcaagggcgttgttaaatgctttgagcataaagatg
ttcaaagaagatgttggggacaatggtcccaagtcttattccatggagttccctttagca
aggaagaaagctaagctacttgatgctcccaagaacaaatcaatggagcttgttcattcc
aaaacctatagaccatcaggtctaagaaactaa

DBGET integrated database retrieval system