KEGG   Brassica rapa (field mustard): 103871561Help
Entry
103871561         CDS       T03449                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp03030  DNA replication
brp03410  Base excision repair
brp03420  Nucleotide excision repair
brp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:brp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    103871561
   03410 Base excision repair
    103871561
   03420 Nucleotide excision repair
    103871561
   03430 Mismatch repair
    103871561
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:brp03032]
    103871561
   03400 DNA repair and recombination proteins [BR:brp03400]
    103871561
Enzymes [BR:brp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103871561
    6.5.1.6  DNA ligase (ATP or NAD+)
     103871561
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103871561
DNA replication proteins [BR:brp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103871561
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103871561
DNA repair and recombination proteins [BR:brp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103871561
   NER (nucleotide excision repair)
    Other NER factors
     103871561
   MMR (mismatch exicision repair)
    Other MMR factors
     103871561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 103871561
NCBI-ProteinID: XP_009148073
LinkDB All DBs
Position
A6
AA seq 772 aa AA seqDB search
MLTIRSSNHFRCISSLFTKTLNPKFSSVSLSFTRPAPHRAMSSSRPSAFDALMSNARASA
AKKKTPQASNPPRSPNKRKIEKTQDSDLVKTEASDSAKPGSDSPSIAEDSKKGAKKSRSL
TQTDKIEEMKSKIALLKKKPGEFDPERVSCWEKGERVPFLFIALAFDLISAESGRIVITD
ILCNMLRTVIATTPDDLVATVYLAANEIAPAHEGVELGIGEGSVIKAISEAFGRTESQVK
KLNTELGDLGLVAKGSRSSQTMMFKPESLTVVKVFNTFRQIAKESGKDSTEKKKDRMKAL
LVAATDCEPLYLTRLLQAKLRLGFSNQTVLAALGQAAVYNEEHSKPPPNTKSPLEEAAKI
VKQVFTVLPVYDIIVPALLSGGVWNLPKTCNFTLGVPIGPMLAKPTKGVGEILNKFQDTV
FTCEYKYDGERAQVHCMEDGTFEIYSRNAERNTGKYPDVALALSRLKKPSVKSFILDCEV
VAFDREKKKILPFQILSTRARKNVNVNDIKVGVCIFAFDMLYLNGQQLIQENLNIRREKL
YESFEEDPGYFQFATTLTSSDIDEIQKFLDASVDIGCEGLIIKTLNSDATYEPAKRSNNW
LKLKKDYMDSIGDSVDLVPIAAFHGRGKRTGVFGAFLLACYDADKEEFQSICKIGTGFSE
AVLEERSTSLRSRVIATPKQYYRVGDSLNPDVWFEPTEVWEVKAADLTISPVHRAATGIV
DPDKGISLRFPRLLRVREDKKPEEATSSEQIADMYQAQKHNHPSNDAKGEDD
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgttaacgattcgatcatcgaatcacttccgatgcatatcttccctcttcactaaaacc
ctaaaccccaaattctcctccgtctcgctctcctttacccgcccagctccccacagagcc
atgtcttcttcacgcccctccgcattcgacgctctcatgtccaacgctcgcgcatccgcc
gccaagaagaagaccccacaagcctccaacccgcctcgctcgccgaacaagaggaaaatc
gaaaaaacccaagactccgatttggtcaagaccgaagcttccgattccgcgaaacccgga
tcggattcaccttcaatcgcggaggattcgaagaagggtgcgaaaaagtctaggtctttg
acccagacggataagatcgaggaaatgaagagcaaaatcgcgttgctgaagaagaagccc
ggcgagttcgatccggagagagtgtcgtgttgggagaaaggggagagagttccgtttctt
tttatcgcgttggcgtttgatttgatctcagctgaaagtgggcggattgtgattactgat
attttatgtaatatgttgagaactgttattgccactactcctgatgatttggtggctact
gtttaccttgcggcgaacgagattgctcctgcgcatgaaggggttgagttggggattggt
gaagggtctgttatcaaggccatctctgaggcttttggtagaacggagtctcaggttaag
aagctaaacacggagcttggagacttggggcttgtagctaaaggaagccgttcgtctcag
actatgatgttcaagccagagtcattgactgttgtcaaggttttcaacacatttcgacaa
attgctaaggaaagtggaaaagatagtacagaaaagaagaaggaccggatgaaggcactc
ctcgtggcagcaacggactgtgaacctctttacttgactcgtctacttcaggcaaaattg
cggttagggttttcaaaccagacggtcttagctgccttgggacaagcagctgtatataat
gaagagcactctaagccacctcctaataccaagtctcctttagaagaggctgcgaagatt
gttaaacaagtattcactgtgcttcctgtctatgacattattgtccccgctcttttatct
ggtggtgtgtggaatctccctaaaacttgtaactttacactcggtgttccaatcggacca
atgcttgcaaaaccaacaaaaggtgtaggtgagatactgaataaattccaagacaccgtc
ttcacatgcgagtacaagtatgatggagaacgtgcacaggtacattgtatggaggatggt
acattcgagatatatagtcgaaatgccgaaagaaacactgggaagtaccctgatgttgct
cttgcgttgtcaagattaaagaagccttctgtgaaatcttttattctggattgcgaagtt
gttgctttcgacagggagaaaaagaaaattctgccatttcagattttgagcactcgagcc
cgtaaaaatgtgaatgtcaacgatatcaaagttggcgtatgcatctttgcttttgacatg
ttatatcttaatggccagcaacttatccaggagaatcttaatattcgccgagagaagcta
tacgaatcatttgaggaagatcctggatatttccagttcgcaacaactctaacgtccagc
gatatagatgaaatacaaaagtttcttgatgcgtccgttgatattggctgtgaagggttg
atcattaaaacattgaattcagatgctacatatgagcctgcaaagcgatcaaataattgg
ctaaaactgaagaaagactacatggacagtattggggactctgtggatcttgtaccaatt
gctgctttccatggacgtggcaaacgcacaggtgtctttggtgcatttttactagcttgc
tacgatgctgataaggaagagtttcaaagcatttgtaaaataggtactggattttctgaa
gctgtacttgaagagcggtctaccagtcttcgctctagagtgattgctactccaaaacaa
tactaccgagttggagacagcctcaatccagacgtttggttcgaacccactgaggtctgg
gaagtaaaggcagctgacttgacaattagccctgtacatcgtgcagctaccggcattgtg
gaccctgataagggaatttctctacgttttccccgtttgctacgtgtacgggaagacaag
aagccagaggaagcaacatcatctgagcagattgctgatatgtaccaagctcagaaacac
aaccatccgagcaatgatgccaaaggtgaagacgactga

DBGET integrated database retrieval system