KEGG   Brassica rapa (field mustard): 103872517Help
Entry
103872517         CDS       T03449                                 

Definition
(RefSeq) alanine aminotransferase 1, mitochondrial-like
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00220  Arginine biosynthesis
brp00250  Alanine, aspartate and glutamate metabolism
brp00710  Carbon fixation in photosynthetic organisms
brp01100  Metabolic pathways
brp01200  Carbon metabolism
brp01210  2-Oxocarboxylic acid metabolism
brp01230  Biosynthesis of amino acids
Module
brp_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:brp00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103872517
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103872517
   00220 Arginine biosynthesis
    103872517
Enzymes [BR:brp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     103872517
Amino acid related enzymes [BR:brp01007]
 Aminotransferase (transaminase)
  Class I
   103872517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR
Motif
Other DBs
NCBI-GeneID: 103872517
NCBI-ProteinID: XP_009149177
LinkDB All DBs
Position
A6
AA seq 537 aa AA seqDB search
MRRFVIGEAKNLIDQTRRRPRPHHNNIRLLSLLASDPIPVSSSRFFSDMTGSDSSSSLPV
TLDSINPNVLKCEYAVRGEIVNIAQKLQDDLKINKDAYPFDEIIYCNIGNPQSLSQQPIT
FFREVLALCSHTALLDRDETHALFSADSIARAWKILDQIPGKATGAYSHSQGIKGLRDAI
AAGIEARDGFPADPNDIFMTDGASPGVHMMMQLLISSEKDGILCPIPQYPLYSASIALHG
GSLVPYYLDEASGWGLEISELKKQLEDAKSKGITVRALAVINPGNPTGQVLSEENQRDIV
DFCKKEGLVLLADEVYQENVYVPDKKFHSFKKVARSMGYGEKDISLVSFQSISKGYYGEC
GKRGGYMEVTGFTSDVREQIYKVASVNLCSNISGQILASLVMSPPKPGDESYESYIAEKE
GILSSMARRAKTLEEALNKLEGITCNRAEGAMYLFPCINLPKKAIAAAEAAKTAPDTFYC
KRLLNATGIVVVPGSGFRQVPGTWHFRCTILPQEDKIPAIVNRLTEFHKSFMDEFRD
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgcggagattcgtgattggcgaagccaaaaatctcatagatcagactcgtcgtcgtcct
cgtcctcatcacaacaacatccgccttctctctctccttgcttccgatcctattcctgtt
tcttcatcgcgtttcttttccgacatgactggctctgattcatcgtcctctctccccgtt
actctcgactccatcaaccccaatgttctgaaatgtgagtatgctgtccgtggagaaatt
gtcaacattgctcagaagttgcaagatgatttgaagattaacaaggatgcgtatcccttt
gatgagattatctactgtaatatcggaaatccacaatctcttagccaacagcctataacg
ttcttcagagaggttcttgctttgtgttcccacacagctttgttggaccgagatgaaaca
catgctttgttcagcgccgattctattgcgcgtgcttggaagattctcgaccagattccc
gggaaagctaccggtgcttacagccacagccagggtatcaagggactacgtgatgcaatt
gctgctggaatcgaagcacgtgatggcttccctgctgatcccaatgatattttcatgaca
gatggtgcaagccctggggttcatatgatgatgcaacttctcataagttctgagaaagat
ggaatcctttgccccattcctcagtaccccttgtactcagcttcaattgcccttcacggt
ggaagtctggttccatactaccttgatgaagcatcaggatggggtcttgaaatatctgag
ctgaagaagcagctggaggatgctaagtcaaagggcatcactgtaagagccttggcggtt
attaaccctggtaacccaacaggacaggttctatcagaagaaaaccagcgtgacattgtt
gacttctgtaagaaagagggactggttcttttagctgatgaggtttatcaggaaaacgtt
tacgtccctgacaaaaagttccactctttcaagaaagtagcccggtctatggggtacggt
gagaaggatatctccttagtctcgttccagtctatctccaaaggatactacggagagtgt
ggaaagagaggaggttacatggaggttactggtttcacttctgatgtgagagagcagata
tacaaagtggcttctgtgaatctttgctccaacatctctggtcagattcttgccagtctc
gtcatgagcccacctaagcctggtgacgagtcatacgagtcatacatagcagagaaagag
ggaatcctctcgtctatggcaagacgtgcaaagactcttgaagaagctctaaacaagttg
gagggtataacatgcaacagagcagaaggagctatgtatctattcccttgcattaacctt
ccaaaaaaggcgattgcggctgcagaagctgcaaagacggcaccggacacgttctactgc
aaacgcctcctaaacgcaactggaatagtcgttgtccctgggtctggatttagacaggta
ccgggaacatggcatttcaggtgcactatacttcctcaagaggataagattccggcaatc
gtgaaccgtctcactgagttccacaagagcttcatggatgagttccgcgactaa

DBGET integrated database retrieval system