KEGG   Brassica rapa (field mustard): 103874443Help
Entry
103874443         CDS       T03449                                 

Definition
(RefSeq) histone deacetylase 2
  KO
K11418  histone deacetylase 11 [EC:3.5.1.98]
Organism
brp  Brassica rapa (field mustard)
Brite
KEGG Orthology (KO) [BR:brp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:brp03036]
    103874443
Enzymes [BR:brp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103874443
Chromosome and associated proteins [BR:brp03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     103874443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 103874443
NCBI-ProteinID: XP_009151116
LinkDB All DBs
Position
A6
AA seq 396 aa AA seqDB search
LAASVTKDIRVVSTWTDLTRDSAVYLLFTFSAIKVSQFIYRCFQSSEMSSFSMETHPEAL
RRERILSSKLYFNVPESKVSIIYSSAYDISFMGIEKLHPFDSTKWRRVCKFLVSDGFLEE
KSIVEPLEASNSDLLVVHSLNYLNSLKSSATVARITEVPPVAFFPNFLVQQKVLSPFRKQ
VGGTILAAKLAVERGWAINVGGGFHHCTAERGGGFCAFADISLCIHFAFLRLSISRVMII
DLDAHQGNGHETDLGDDSRVYILDMYNPEIYPYDYSARRFIDQKVEVMSGTSTDEYLRKL
DKALEVAFRNFQPEMVVYNAGTDILDGDPLGLLKISPDGITSRDEKVFRVAREREVPVVM
LTSGGYMKSNARVIADSIENLSRQGLIKTQLDSAST
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ctcgccgcttcagtcacgaaagatatccgagttgtctcgacatggaccgatttaactcgt
gactcagctgtttacttgctattcacgttttccgccatcaaagtctcccaatttatctac
cgttgctttcaatcatccgaaatgtcatcgttctcgatggagactcacccggaagctctc
aggcgagaacgaatcctttccagcaaactctacttcaacgtccccgaatcaaaggtttcg
atcatctattcatcagcatacgacatctccttcatggggattgagaagttgcatccgttt
gattcaaccaagtggcgtcgagtttgtaagttccttgtttctgatgggttcttggaggag
aaatcaatcgttgagcctctagaagcttccaacagtgatcttctagtggtacattcgttg
aactacttaaacagtttgaaaagcagtgcaactgtcgctaggataaccgaggttccacca
gttgctttcttcccaaactttcttgtgcagcagaaggttctaagcccattccgaaagcag
gttggtgggacgattctagcagctaaacttgcagtggaacgtggatgggcaataaacgta
ggaggaggttttcatcattgtactgctgaaagaggaggcgggttttgtgcttttgctgat
atctctctttgtattcactttgcttttcttcgtctaagcatctcccgggttatgataata
gatcttgatgctcatcaagggaatggccatgaaacagatcttggcgatgatagtcgtgtt
tacattctggatatgtataatcctgagatatacccttacgattatagtgctagaagattt
atcgatcagaaggttgaagtgatgagcgggaccagcactgatgagtatttgaggaaacta
gataaagcgcttgaggttgctttccgaaacttccaaccagagatggtagtttacaatgct
ggaaccgatatcttagacggagaccctctggggcttctaaagataagccctgatggtata
acaagcagagacgagaaagtcttcagagttgcaagggagagagaggttcctgttgtgatg
ctgacttcaggcgggtacatgaagtccaacgccagagttattgcggattccatagagaat
ctctcacgtcaagggttaatcaagacacaactggactcagcttccacgtga

DBGET integrated database retrieval system