KEGG   Bradyrhizobium sp. 2 39S1MB: CIT40_06665Help
Entry
CIT40_06665       CDS       T05700                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
brq  Bradyrhizobium sp. 2 39S1MB
Pathway
brq00564  Glycerophospholipid metabolism
brq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CIT40_06665
Enzymes [BR:brq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CIT40_06665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AWL99739
UniProt: A0A2U8PPP6
LinkDB All DBs
Position
1413366..1414916
Genome map
AA seq 516 aa AA seqDB search
MRLLERIFDLAIIGGGVNGCGIARDAVGRGNTVFLCEMNDLASGTSSWSTKLVHGGLRYL
EYYEFRLVREALIEREILWGIAPHIIRPLRFVLPHHSGLRPAWLLRLGLFLYDHIGGRHL
LPATRSVDLRRDEVGKPLIPNRYSRAFEYSDCFVDDARLVVLNARDAADKGAEIRTRTRA
TDIKQSGGLWTVSMVNTLTGERSQIQAKALVNAGGPWVEDVLGRGAGVNAKAKVRLVQGS
HIVVRKLYDHDRAYMFQNADGRIIFVIPYQDDFTLIGTTDRDYDGDPAKVKATPEEVQYL
CTAASEYLAKPVTPDDVVWTYSGVRPLYDDGASEAKAATRDYVFELDTPGGVPLLSIYGG
KITTYRRLAEEALERLAPYLRSAKAREGWTGKWPLPGGDMNVSDIDGLIAELQRGYPFLS
HEHARRLARAYGTKAIKLLGDAKSSADLGQAFGATLTEREVRYLMANEWAVTAEDVVWRR
SKLGLRLSADEIAALDDWIATHAVPQSPLLEAGGRS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgttggagcgtattttcgacctcgccatcattggaggcggtgttaatggctgc
ggcatcgcgcgcgacgcggtgggccgcggcaacacggttttcctgtgcgaaatgaacgat
ttggcgagcgggacatcgtcctggtcgaccaagctggtccatggcggcctgcgctatctc
gaatattacgagtttcgcctggttcgcgaggcgctgatcgagcgcgagatcctctggggc
atcgcgccccacatcatccgccccctgcgtttcgtattgccgcatcactctggcctgcgc
cccgcttggctgctgcgtctcggcctcttcctctatgaccacatcggcggccgccatctg
ttgccggcgacccgctcggtcgatctccggcgtgacgaggtcggcaagccgctgatcccg
aatcgctactcccgcgccttcgaatattccgactgcttcgtcgacgacgcccgcctcgtc
gtgctcaatgcgcgcgatgccgccgacaagggtgccgagatccgcacccgcacccgcgca
acggatatcaagcagtccggcggtctctggaccgtgagcatggtcaacacgctgacgggt
gagcggtcgcagatccaggcaaaggctctggtcaatgccggcggcccctgggtcgaggac
gtgctcggccgcggcgccggcgtcaacgcgaaagccaaggtgcgcctggtgcagggctcg
cacatcgtggtcaggaagctctacgaccacgaccgcgcctacatgttccagaacgccgac
ggccgcatcattttcgtgatcccgtaccaggacgacttcacgctgatcggcaccacggat
cgcgactatgacggcgatcccgccaaggtgaaggcgacgccggaggaggtccagtatctc
tgcaccgcggcgagcgaatatctggcgaagcccgtgacgccggacgacgtggtctggacc
tattccggtgtgcgcccgctctatgacgacggcgccagcgaagccaaggccgcgacgcgg
gactacgtgttcgagctcgacacgcccggcggcgtgcctctgctgtcgatctatggcggc
aagatcaccacctatcgccggctcgccgaggaggcgctggagcggctcgcgccctatctt
cgcagcgcaaaagcgcgggagggctggacgggcaaatggccgctgcccggcggcgacatg
aatgtgtccgacatcgacggcctgatcgccgagctgcagcgcggctatcccttcctcagc
cacgagcacgccaggcggctcgcgcgcgcctatggcaccaaggccatcaagctgctcggc
gacgccaaatcgtcggccgatctcggccaggcctttggtgcgacgttgaccgaacgcgag
gtccgctacctcatggccaatgaatgggccgtgaccgccgaggacgtcgtctggcgccgt
tccaagctcggcctgcgactatctgccgatgagatcgctgcacttgacgactggattgca
acccacgctgtgccgcaaagtcccctgctggaagcgggaggacgctcatga

DBGET integrated database retrieval system