KEGG   Bradyrhizobium sp. 2 39S1MB: CIT40_09255Help
Entry
CIT40_09255       CDS       T05700                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
brq  Bradyrhizobium sp. 2 39S1MB
Pathway
brq00620  Pyruvate metabolism
brq00680  Methane metabolism
brq00710  Carbon fixation in photosynthetic organisms
brq01100  Metabolic pathways
brq01120  Microbial metabolism in diverse environments
brq01200  Carbon metabolism
Module
brq_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:brq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CIT40_09255
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CIT40_09255
   00680 Methane metabolism
    CIT40_09255
Enzymes [BR:brq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CIT40_09255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AWM00199
UniProt: A0A2U8PQY8
LinkDB All DBs
Position
2019329..2022118
Genome map
AA seq 929 aa AA seqDB search
MSLQTVSSDNTDRLNRPEDPQALEADARLRDDIRLLGRILGDTVRDQEGADVFDLVERIR
QTSIRFHRDEDRLARRELEQILDSMSTSETVRIVRAFSYFSHLANIAEDQNNIRQMRARS
AGKSTGVLAETLAHAKAAGIGPDQLRSFFKSALVSPVLTAHPTEVRRKSTMDREMEVAGL
LDHRERVALTAEEAAASDEQLRREVLTLWQTNLLRRTKLTVLDEVANGLSFYDYTFLREV
PRLVNALEDRLEEGGEQAASELASFLRMGSWIGGDRDGNPFVTADVMRGTLRLQSSRVMQ
FYLEELHVLGSELSIAAHLADVSEELRKLAERSPDTSPHRSGEPYRLAVSGIYARLTATA
EMLQVEITRRPVGKGAPYASVKELQADLDVLHRSLISNNARVIARGRLRLLRRAVDCFGF
HLARLDIRQNSAVHERTIAELMDAANPGMSYLALGEDARISLLTNELRSTRALVSPFVKY
SDETMGELNVFHAAAEAHVKFGSDAIPQCIISMCKGMSDMLEVAVLLKEVGLVHPSGRSA
INIVPLFETIEDLQASSGIMDRMLSLHDYRRLVDSRGSVQEVMLGYSDSNKDGGFVTSGW
ELYKAEINLVEVFERHHVRLRLFHGRGGSVGRGGGPSYDAIIAQPGGAVNGQIRITEQGE
IISSKYSNAEVGRNNLEILAAATLEASLLHPRQSAPRREYLTAMDELSNLAFKAYRGLVY
ETEGFVDYFWSSTVINEIATLNIGSRPASRKKTRAIEDLRAIPWVFSWAQCRLMLPGWYG
FGSAVEQWIAEHPDKGMPFLKELYQEWPFFRMLLSNMDMVLAKSSIAIASRYAELVPDEA
LREKIFGRIRREWHASIETLLDIMGQDRLLQGNPLLERSVRHRFPYLDPLNHVQVELLKE
HRAQNPDEQVLRGIQLTINGISAGLRNTG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgtccctccaaaccgtatcatccgacaacacagatcggctcaatcgtcccgaggacccc
caggcgttggaggccgacgcccggctgcgcgacgacatccgcctgctcggacgcatcctc
ggcgacaccgtacgcgaccaggagggtgccgatgtgttcgacctggtcgaacgcatccgc
cagacctcgatccggtttcaccgcgacgaggaccggcttgcccgccgcgagctcgagcag
atcctcgacagcatgtcgacctccgagacggtacggatcgtccgcgccttcagctatttc
tcccacctcgccaacatcgccgaggaccagaacaacatccgccagatgcgggcccgcagc
gccggcaagagcacgggcgtgctggccgagacgctcgcccacgccaaggcggcgggcatc
ggccccgatcagctccgcagcttcttcaagtcagcgctggtcagcccggtgctgaccgcg
cacccgaccgaagtccgccgcaagagcaccatggaccgcgagatggaggtcgcaggcttg
ctcgaccaccgcgagcgcgtggcgctgaccgcggaggaggccgctgcctccgacgagcag
ctgcgccgcgaggtgctgacgctgtggcagaccaacctgctgcgccggaccaagctcacc
gtgctcgacgaggtcgccaacggcctgtcgttctacgattacaccttcctgcgcgaggtg
ccgcggctggtcaacgcgctggaagaccggctggaggagggcggcgagcaggcagcctcc
gagctcgcctcgttcctgcgcatgggcagctggatcggcggcgatcgcgacggcaatccc
ttcgtgactgccgacgtgatgcgcggcacgctgcggctgcagtcgagccgggtcatgcag
ttctatctggaagagctacatgtgctcggctcggaattgtcgatcgcagcgcatctcgcc
gacgtctccgaggagttgcgcaagcttgcggagcgttcgcccgacacctcgccgcaccgg
agcggcgagccctatcgcctcgcggtctccggcatctatgcgcgcctgacggcgacggcc
gaaatgctgcaggtcgagatcacgcgccggccggtcggcaagggcgcgccatatgcgagc
gtgaaggagctgcaggccgatctcgacgtgctgcaccgctcgctgatctccaacaacgcc
cgcgtcatcgcgcgcggccggctgcggctgctgcgccgcgccgtcgactgcttcggcttc
cacctcgcccggctcgacatccgccagaactcggcggtgcacgagcgcaccatcgccgag
ctgatggacgccgccaatcccggtatgtcctatctcgcgctcggcgaggacgcccgcatc
tcgctgctgacgaacgaactgcgctcgacgcgcgcgctggtctcgcccttcgtcaaatac
agcgacgagaccatgggcgagctcaacgtgttccatgccgccgccgaagcgcatgtgaag
ttcggctcggacgccattccccaatgcatcatctcgatgtgcaagggcatgtccgacatg
ctcgaggtcgcagtgctcttgaaggaggtcggcctcgtccatccttccggccgcagcgcc
atcaacatcgtgccgctgttcgagacgatcgaggatctgcaggcctcctcaggcatcatg
gatcgcatgctgtcgctgcacgattaccgtcgcctggtcgacagccgcggcagcgtgcag
gaggtcatgctcggctattccgacagcaacaaggacggcggcttcgtcacctcgggctgg
gaactctacaaggccgagatcaacctcgtcgaggtgttcgagcggcatcacgtgcggctg
cgcctgttccacggccgcggcggctcggtcggtcgcggcggcggtccgagctatgacgcc
atcatcgcccagcccggcggcgcggtgaacggccagatccgcatcaccgagcagggcgag
atcatctcgtcgaaatattccaacgccgaagtcggccgcaacaatctggaaatcctcgcc
gccgcgacgctggaggcgagcctgttgcatccgcgccagagcgcgccgcgccgcgaatac
ctcaccgcgatggacgagctgtcgaacctcgctttcaaggcctatcgcggcttggtctac
gagaccgagggcttcgtcgattatttctggtcctcgaccgtcatcaacgagattgcgacg
ctgaacatcggcagccgtccggcctcgcgcaagaagacccgcgcgatcgaggatctgcgc
gccatcccctgggtgttctcatgggcgcaatgccgcctgatgctgccgggctggtacggc
ttcggcagcgcggtcgagcagtggatcgcggaacatcccgacaagggcatgccgttcctg
aaagaactctaccaggaatggccgttcttccgcatgctgctgtcgaacatggacatggtg
ctcgcgaaaagctcgatcgcgatcgcctcgcgctatgccgagctggtgccggatgaagcg
ctgcgcgaaaagatcttcggccgcatccgccgcgaatggcacgcctcgatcgagacgctg
ctcgacatcatgggccaggatcggctgctgcagggcaatccgctgctggagcgctcggtg
cgccaccgcttcccctatctcgatccgctcaaccacgtgcaggtcgagctgttgaaggag
caccgcgcgcagaacccggacgagcaggtgctgcgcgggattcagctgaccatcaacggg
atctcggcggggttgaggaatacggggtaa

DBGET integrated database retrieval system