KEGG   Bradyrhizobium sp. 2 39S1MB: CIT40_18440Help
Entry
CIT40_18440       CDS       T05700                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
brq  Bradyrhizobium sp. 2 39S1MB
Brite
KEGG Orthology (KO) [BR:brq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CIT40_18440
Enzymes [BR:brq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     CIT40_18440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Methyltransf_25 ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: AWM01821
UniProt: A0A2U8PW39
LinkDB All DBs
Position
3964853..3965884
Genome map
AA seq 343 aa AA seqDB search
MRAVVIHAPKDLRIDNYPDPAPGPGEVRVKIANGGICGSDLHYYHHGGFGVVRIQQPMAL
GHEIAGVVAAIGDGVTSVKPGTRVAVNPSRPCGQCLHCQEGMRNQCLDMRFLGSAMRFPH
VQGGFREFITVDATQAVPIADKLSLAEAAVAEPLAVCLHAGKQAGPLLGKRVLITGCGPI
GALMILVSRFGGASEIVVTDVADAPLAVARKLGATHAINVATDASALDPWRAGKGVFDTL
FEASGNQAALRAALDVLRPGATLVQLGLGGEMTLPINSIVAKELQLRGTFRFDPEFELAV
RLMGEGLIDVKPLITATMPFENAIAAFELASDRAQSMKVQLTF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgtcgtcattcacgccccgaaagatctgcggatcgacaattatcccgatccg
gcgcccggcccgggcgaggttcgcgtcaagatcgccaatggcggcatctgcggctccgat
ctgcactattaccatcacggcggcttcggcgtggtgcgcatccagcagccgatggcgctg
gggcacgagatcgccggcgtggtcgccgcgatcggtgatggcgtcaccagcgtgaaacct
ggcacgcgcgtcgcggtcaatccgagcaggccgtgcggccagtgcctgcattgccaggaa
ggcatgcgcaaccagtgcctcgacatgcgcttcctcggcagcgcgatgcgctttccccat
gttcaaggcggttttcgcgagttcatcacggtcgatgccacgcaggccgtgccgatcgcc
gacaagctctcgctggcggaagctgcggtcgccgaaccgctcgcggtgtgcctgcatgcc
ggcaagcaggccggtcccctgctcggcaagcgcgtgctgatcacgggctgcggtccgatc
ggcgcgctgatgattttggtctcgcgcttcggcggcgcgtccgagatcgtggtgactgac
gtggccgacgcgccgctggccgtcgcgagaaagctcggcgcgacgcatgccatcaacgtc
gccaccgatgccagcgcactcgatccctggcgcgccggcaagggcgtgttcgacacgctg
ttcgaggcctcgggtaaccaggcagcgctccgcgccgcgctcgacgtgctccggcccggc
gcgacgctggtgcagctcggcctcggcggcgagatgacgctgccgatcaattccatcgtt
gccaaggaattgcagctgcgcggcaccttccgcttcgatcccgagttcgagctggcggtg
cgcctgatgggtgaaggcctgatcgacgtcaagccgctgatcacggccacgatgccgttc
gagaacgcgatcgccgccttcgagctcgccagcgatcgcgcgcagtcgatgaaggtgcaa
ctgacgttctga

DBGET integrated database retrieval system