KEGG   Bradyrhizobium amphicarpaeae: CIT40_21495Help
Entry
CIT40_21495       CDS       T05700                                 

Definition
(GenBank) cystathionine gamma-synthase family protein
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
brq  Bradyrhizobium amphicarpaeae
Pathway
brq00270  Cysteine and methionine metabolism
brq00450  Selenocompound metabolism
brq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CIT40_21495
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CIT40_21495
Enzymes [BR:brq01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     CIT40_21495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AWM02342
UniProt: A0A2U8PX95
LinkDB All DBs
Position
complement(4565814..4567097)
Genome map
AA seq 427 aa AA seqDB search
MVKPFPSKTHIGNHMLHPETLMLTYGYDPQLSEGAIKPPVFLTSTFVFKTADDGQDFFDF
VAGRREPPEGMGAGLVYSRFNHPNSEIVEDRLSIYERTEKCALFSSGMAAIATTILAFVR
PGDVILHSQPLYGGTETLLTNTLARLSIGAVGFADGIDEASVQQAAEEAMAKGRVSMILI
ETPANPTNGLVDVAMIRRIADSIGKAQGDTPIIACDNTLLGPVFQRPIEHGADISLYSLT
KYVGGHSDLIAGAALGSKALMKGIKALRGAIGTQLDPHSCWMISRSLETLSLRMEKADAN
ARLVADYLRDHPKVAKVHYLGHHEEASPAGRVFARQCLGAGSTFSFDIVGGKDAAVKFLN
ALQIIKLAVSLGGTESLASLPATMTHSGVPADIRRKIGVLDSTIRLSIGIENPSDLIADL
TQALNAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaaccgtttccgtcgaagacgcacatcggcaatcacatgctgcatcctgaaacg
ctgatgctgacctatggctatgatccgcagctgtcggaaggcgccatcaagccgccggtg
ttcctgacctccaccttcgtgttcaagacggccgatgacgggcaggactttttcgacttc
gtcgccggccggcgcgagccgccggaaggcatgggcgcgggcctggtctattcgcgcttc
aatcaccccaacagcgagatcgtcgaggacaggctctcgatctacgagcgtaccgagaag
tgcgcgctgttctcgtccggcatggcggcgatcgcgaccacgatcctggctttcgttcgt
cccggcgacgtcatcctgcactcccagccgctctatggcgggacggagacgctgctgacg
aacacgctggcgcgtctgtcgatcggcgccgtcggcttcgccgacgggattgatgaggcc
tccgtccagcaggcggcagaggaggccatggccaagggccgcgtgtcgatgatcctgatc
gaaactccggccaacccgaccaacggtctggtcgatgtcgccatgatccgccgcattgcc
gattccatcggcaaggcgcagggcgacacgccgatcatcgcctgcgacaacacgctgctc
ggaccggtgtttcaacggccgatcgagcacggcgccgacatttctctctactcgctcacg
aaatatgtcggcggtcactccgatctgatcgctggcgcagcccttggttcgaaggcgctg
atgaagggcatcaaggcgctacgcggcgccatcggaacgcaactcgatccgcattcctgc
tggatgatcagccgctcgctcgagacgctgagcctgcgcatggaaaaagccgatgcgaat
gcgcgcctcgtggcggattatttgcgcgatcaccccaaggtggccaaggttcactacctc
ggtcatcacgaggaggcctcgcccgcgggccgtgtgttcgcgcggcaatgcctgggggcg
ggatcgaccttttcgttcgacatcgtcggcggcaaggacgcggcggtcaaattcctcaat
gcgctgcagatcatcaagctggcggtcagtctcggcggcaccgagtcgctcgcgagcctg
cccgcgaccatgacgcattccggcgttcccgccgacatccgccggaaaatcggcgtgctc
gattccacgatccggttgtcgatcggcatcgagaacccgtcggacctgatcgcggacctc
acgcaggcgctgaacgcggcctga

DBGET integrated database retrieval system