KEGG   Bradyrhizobium sp. 2 39S1MB: CIT40_23825Help
Entry
CIT40_23825       CDS       T05700                                 

Definition
(GenBank) ferredoxin:protochlorophyllide reductase (ATP-dependent) iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
brq  Bradyrhizobium sp. 2 39S1MB
Pathway
brq00860  Porphyrin and chlorophyll metabolism
brq01100  Metabolic pathways
brq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CIT40_23825
Enzymes [BR:brq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     CIT40_23825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MeaB AAA_24 AAA_26 MipZ CBP_BcsQ NB-ARC AAA_25
Motif
Other DBs
NCBI-ProteinID: AWM02756
UniProt: A0A2U8PY78
LinkDB All DBs
Position
complement(5090578..5091489)
Genome map
AA seq 303 aa AA seqDB search
MNIQTKPSSLKSPSCCGDGEGSVQVQLDPKLKIGTAKVFSVYGKGGIGKSTTSSNLSVAF
SKLGKRVLQIGCDPKHDSTFTLTKRLVPTVIDVLESVNFHAEELRPEDFVFEGYNGVMCL
EAGGPPAGTGCGGYVVGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHSDRALI
VAANDFDSIFAMNRIVAAIEAKSRNYGVRLGGVIANRSKDTDQIDRYSEQAGLRRVAHFP
DLDVIRKSRLKKSTLFEMDETPELKAVTDEYMRLAAELWAGTIEPLPGKSLKDREIFDLL
GFD
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccaaaccaaaccatcgtcgctcaagagcccgtcctgctgcggcgacggcgag
ggcagcgtgcaggttcagctcgatccgaagctcaagatcggcaccgcaaaggttttctcg
gtctacggcaagggcggtatcggcaagagcacgacgtcgtcgaacctgtcggtcgcgttc
tcgaagctcggcaagcgcgtccttcagatcggctgcgaccccaagcacgactcgaccttc
accctgaccaagcgcctggtcccgaccgtaatcgacgtgctggaatccgtgaacttccac
gccgaggaacttcgccctgaggatttcgtgttcgaaggctacaatggcgtgatgtgcctg
gaggccggtgggcctccggcaggcaccggctgcggcggttacgtcgtgggccagaccgtg
aaactcttgaaggaacaccatctgctcgaagacaccgacgtggtgatcttcgacgtgctt
ggcgacgtcgtctgcggcggcttcgctgcgcccttgcagcactccgaccgtgcgttgatc
gttgcggcgaatgatttcgactccatcttcgcgatgaaccgcatcgtggccgcgatcgag
gccaagtcgagaaactacggagtccggctcggcggcgtgatcgccaaccgcagcaaggat
accgatcagatcgatcgctacagcgagcaggccgggttgaggcgggtcgctcatttcccc
gatctcgacgtcatccgcaaaagccgcctgaagaagtcaacgctgttcgaaatggacgag
acgcctgaattaaaggccgtcacggacgaatacatgcggctcgccgccgagctctgggcc
ggaacgatcgagccgttgcctggaaaatcgttgaaagaccgtgaaatcttcgatctgttg
gggttcgattga

DBGET integrated database retrieval system