KEGG   Bradyrhizobium sp. 2 39S1MB: CIT40_31005Help
Entry
CIT40_31005       CDS       T05700                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
brq  Bradyrhizobium sp. 2 39S1MB
Pathway
brq00500  Starch and sucrose metabolism
brq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CIT40_31005
Enzymes [BR:brq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CIT40_31005
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CIT40_31005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AWM04024
UniProt: A0A2U8Q1U5
LinkDB All DBs
Position
6608992..6610689
Genome map
AA seq 565 aa AA seqDB search
MIDDLWYKNGVIYCLSVGTYMDANGDGVGDFKGLLRRLDYLHGLGITTIWLMPFQTSPGR
DDGYDIADYYSVDPRYGTLGDFVEFAHGCKQRGIRIIIDLVVNHTSDQHHWFKEARRDKN
SPYRDWYVWSDKKPANANTGMVFPGVQKTTWTRDKEAGAYYFHRFYDFQPDLNTSNPHVQ
AEILKIMGFWIQLGVSGFRMDAVPFVIATKGAKVKKPVEQYDMLRSFREFLQWRQGDAII
LAEANVLPKTDMEYFGRDGDRMHMMFNFHVNQHLFYALASADSRPLAKALKATKPRPAAA
QWGLFLRNHDELDLGRLTKAQRDLVFKRFGPDKDMQLYDRGIRRRFAPMVGGDRRRLELA
YSLMCTLPGTPVIRYGDEIAMGDDLSLPERNCARTPMQWSTEPHGGFTKSDKPACPVIDT
GPYGYPHVNVAKQRRDPNSMLNWTERIIRMRKEVPEIGWGDFAIIATRDPAVFIMRYDWR
NNSVLFVHNLDETPREIAFSVGLPGEAGAHLINLLAEDHSHADKRGQHRIVLEPYGYRWY
RVGGLDYLLKRSDIDGSTAGNKHPG
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgatctctggtacaagaacggcgtgatctattgcctctccgtcggcacctat
atggatgccaacggcgacggggtcggcgacttcaagggcctgctgcgccggctcgactat
ctgcacgggctcggcatcaccacgatctggctgatgccgttccagacttcgcccggccgc
gacgacggctacgacatcgccgattattacagcgtcgatccccgctacggcacgctcggc
gacttcgtcgaattcgcccatggctgcaagcagcgcggcatccgcatcatcatcgatctc
gtcgtcaaccacacctcggaccagcaccattggttcaaggaggcgcggcgcgacaagaat
tcgccctatcgcgactggtacgtgtggtcggacaagaagcctgccaatgccaacacgggc
atggtgtttcccggcgtgcagaaaacgacatggacgcgcgacaaggaggccggcgcgtat
tatttccatcgcttttacgatttccagcccgatctcaacacgtcgaacccgcatgtccag
gccgagatcctgaaaatcatgggcttctggatccagctcggcgtctccggcttccggatg
gacgccgtgcccttcgtgattgccaccaagggcgccaaggtgaagaagccggtcgaacag
tacgacatgctgcgctcattccgcgaattcctgcaatggcggcagggcgacgccatcatc
ctggccgaagccaatgtgctgccgaaaacagacatggagtatttcggccgcgatggcgac
cgcatgcacatgatgttcaacttccacgtcaatcagcacctgttctatgcgctggcctcg
gccgattcgcgtcctctggcgaaggcgctgaaagcgaccaagccgcggccggccgcggcg
caatggggcctgttcctgcgcaatcacgacgagctcgatctgggacggttgaccaaggcg
cagcgcgacctcgtcttcaaacgcttcggccccgacaaggacatgcagctctacgaccgc
ggcatccggcgccgcttcgccccgatggtcggcggcgaccgcaggcggctcgagctcgcc
tatagcctgatgtgcacgctgccgggaacgcccgtgatccgctatggcgacgagatcgcg
atgggcgacgatctctcattgccggaacgcaattgcgcgcgcacgccgatgcaatggtcg
acagagccgcatggcggcttcaccaagagcgacaagccggcctgccccgtgatcgacacg
gggccgtacggctatccgcacgtcaacgtcgccaagcagcggcgcgatcccaactcgatg
ctgaactggaccgagcgcatcattcgcatgcgcaaggaggtgcctgaaatcggctggggc
gatttcgcgatcattgcgacacgcgatcccgccgtgttcatcatgcgttacgactggcgc
aacaattcggtgctgttcgtgcataatctcgacgagacgccgcgcgagatcgcgttctcg
gtggggctgccgggcgaggccggcgcgcatctgatcaatctgctcgcggaggaccacagc
cacgccgacaagcgcggccagcaccgaatcgtgctggagccatatggctatcgctggtat
cgcgtcggcgggctggattatctgctgaagcgaagcgacatcgacgggagtaccgccggc
aacaagcatccggggtga

DBGET integrated database retrieval system